Vintage Inspired Moissanite Flower Engagement Ring

Regular price $592.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Romantic Design with Vintage Character

This vintage inspired moissanite flower engagement ring is crafted for those who appreciate intricate design and timeless expression. The floral motif brings a soft, romantic feel, making it an ideal choice for someone drawn to heritage-inspired jewelry with a distinctive identity.

Its delicate structure and thoughtful detailing offer a graceful presence, balancing elegance with visual interest.

Floral Composition with Artistic Detail

The flower-inspired arrangement creates a layered effect that adds depth and dimension to the ring. Each element is positioned to form a cohesive pattern, enhancing the overall aesthetic while maintaining symmetry.

Unlike traditional solitaire styles, this design focuses on composition and texture, making it suitable for those seeking something more expressive and design-led.

Moissanite for Lasting Brilliance

Moissanite is chosen for its consistent sparkle and clarity, making it well suited for engagement jewelry that is worn regularly. Its reflective qualities support the intricate design, allowing light to interact across the surface of the ring.

It offers a reliable option for those who want visual brilliance without compromising on everyday practicality.

Designed for Daily Wear

Despite its detailed appearance, the ring is structured to sit comfortably on the finger. The design allows for a balanced feel, helping it remain wearable throughout the day.

This combination of detail and comfort makes it suitable for long-term wear as an engagement ring.

A Distinct Choice for Personal Expression

This ring appeals to individuals who prefer a design that reflects personality and artistry rather than minimalism. Its vintage inspiration and floral structure create a unique alternative to more conventional engagement styles.

It pairs well with both classic and modern wardrobes, offering versatility while maintaining its signature look.

Product Information
SKU SHP-RINGS0821233285
Width 5 mm
Height 11 mm
Weight 2.30 gm (Approximate)
Center Stone Weight 0.69 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 39 Pieces
Total Weight 0.69 Carat (Approximate)
Dimension(approx) Oval-4X6 mm-1 Pcs
Round-0.90X0.90 mm-22 Pcs
Round-1.30X1.30 mm-16 Pcs
Color White
Cut Brilliant
Shape Oval, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-engagement-rings

Faq About: Vintage Inspired Moissanite Flower Engagement Ring

Is this ring suitable for everyday wear?
Yes, the ring is designed to offer both comfort and durability, making it appropriate for regular wear.
What makes this ring different from a solitaire design?
This ring features a floral arrangement that focuses on design detail and structure, rather than a single central stone.
Is moissanite a good choice for engagement rings?
Moissanite is widely chosen for engagement rings due to its consistent brilliance and suitability for long-term wear.
Will the detailed design require special care?
Like all fine jewelry, regular cleaning and careful handling help maintain its appearance, especially with intricate designs.
Is this ring comfortable for long wear?
Yes, it is designed with balance and structure in mind to ensure a comfortable fit throughout the day.
Can this ring be paired with a wedding band?
Yes, it can be paired with compatible bands depending on the preferred style and fit.