Vintage Inspired Aquamarine Diamond Leaf Earrings

Sale price $981.00 Regular price $1,102.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Capture the charm of timeless elegance and nature’s beauty with these exquisite Vintage Inspired Earrings. Designed to enchant, each earring features a 4 mm Round Shape Aquamarine placed gracefully within a delicate Leaf Motif, symbolizing growth, renewal and everlasting grace. The intricate design is further elevated by glittering Diamond stones that line the leaf, adding a touch of vintage sparkle that feels romantic. Secured with a Screw Back Closure for lasting comfort and wear, these Leaf Earrings blend classic artistry with modern craftsmanship. Whether paired with an elegant gown or a chic ensemble, these Aquamarine Diamond Earrings bring a whisper of sophistication and a glow of natural beauty to any occasion. Presented in a signature jewelry box, these Aquamarine Ear Studs make a heartfelt gift for anniversaries, birthdays or simply to celebrate someone special. With their captivating sparkle, these Aquamarine Studs are a poetic expression of love, nature and timeless style.

Product Information
SKU SHP-EARRINGS082310496
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 0.85 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 2 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More