Simple Diamond Solitaire Triangle Cartilage Earring

Sale price $688.00 Regular price $791.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

If you have enough room to stack and express your style in a unique way. All you need is this Diamond Solitaire Triangle Earring. Showcasing a dainty Round Diamond secured by 3 Prong Setting on a triangular motif, crafted with Solid Metal to make it a durable choice. Perfectly designed to adorn your Helix, Conch, Cartilage, Tragus, or Upper Lobe Piercing, its the ideal piece of jewelry to effortlessly elevate your everyday or special occasion ensemble. Give the mesmerizing Diamond Geometric Earring to someone close to your heart, as it makes a precious gift for her. The sleek flat back closure guarantees a snug and comfortable fit, making it perfect for everyday use or special events. Whether worn by itself as a standout accessory or combined with other earrings, it brings a sophisticated flair to any outfit. The diamond is meticulously chosen for its HI color and SI clarity, providing the piece with a luminous shine that enhances your natural grace. This Diamond Cartilage Earring merges modern style with classic elegance. Its adaptable design makes it appropriate for both formal and casual occasions, seamlessly enhancing any ensemble. This Helix Earring is a chic option for trendsetters who wish to showcase their individuality through refined details.

Product Information
SKU SHP-BODYJ082410055
Metal Weight 0.52 gm (Approximate)
Total Stone Weight 0.14 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 1 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More