Simple Diamond Open Circle Earring with Flat Back

Regular price $900.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Simply stunning, this Diamond Open Circle Earring is a stylish way to upgrade your ear stack. Crafted in solid metal, featuring round diamonds in pave set on an open circle motif.

  • Style this diamond geometric earring on your piercings like a helix, cartilage, or upper lobe piercing. The flat back closure will keep it intact in place.
  • Our sparkling diamond piercing earring is just perfect for any occasion, from casual gatherings to formal soirees.
  • This minimal and captivating gold circle earring is a perfect unforgettable gift, token of affection to surprise your loved one.
Product Information
SKU SHP-BODYJ082410134
Metal Weight 0.80 gm (Approximate)
Total Stone Weight 0.15 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 15 Pieces
Total Weight 0.15 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-15 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More