Round Moissanite Star Earring for Cartilage Piercing

Regular price $847.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Give your ear stack a little extra shine with this beautiful Moissanite Star Earring. Designed to add charm and sparkle to your cartilage piercing, this piece is both stylish and fun. At the center of the star motif, you will find sparkling round moissanite stones set in pave setting. The tiny stones are placed closely together, creating a bright and eye-catching effect that makes the star design stand out. The shimmer from the moissanites gives this Star Cartilage Earring a lively and attractive look. The star shape adds a playful and slightly dreamy vibe to your style. It is perfect for anyone who loves unique jewelry with a little personality. Whether you are dressing up for an event or just adding detail to your everyday outfit, this Moissanite Celestial Earring blends easily with different looks. This piece is ideal for helix, cartilage, or upper lobe piercings, making it a versatile addition to your collection. You can wear it alone for a simple statement or pair it with other pieces for a trendy layered ear style. It also comes with a flat back closure, which makes it comfortable to wear throughout the day.

Product Information
SKU SHP-BODYJ052210082
Metal Weight 0.70 gm (Approximate)
Total Stone Weight 0.19 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 7 Pieces
Total Weight 0.19 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings