Round Cut Moissanite Infinity Engagement Ring

Sale price $547.00 Regular price $629.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Make a timeless statement with this Moissanite Engagement Ring, a perfect reflection of love that lasts forever. At the heart of this captivating design lies a 7 MM round cut moissanite, securely nestled in prong setting. The band is thoughtfully crafted with a graceful infinity inspired twist, intertwining two paths into one unified design. This elegant motif represents a bond that is eternal, two souls forever connected. Along the shoulders of the band, petite round moissanites accent shimmer delicately, adding just the right amount of sparkle without overshadowing the center stone. Crafted with care and precision, this Infinity Engagement Ring is a beautiful blend of symbolic meaning and refined beauty. The D-VS1 quality moissanite stones offer high clarity and unmatched brilliance, making this Round Engagement Ring not only an eye-catching piece but also a mindful and luxurious alternative to traditional diamonds. Its contemporary charm and timeless elegance ensure it will be cherished for a lifetime. Presented in a beautifully crafted jewelry box, this Solitaire Moissanite Ring is ready to become the centerpiece of your love story, a symbol of forever, wrapped in brilliance and grace.

Product Information
SKU SHP-RINGS112210048
Metal Weight 2.40 gm (Approximate)
Center Stone Weight 1.36 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 19 Pieces
Total Weight 1.51 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-4 Pcs
Round-1.20X1.20 mm-4 Pcs
Round-1.30X1.30 mm-6 Pcs
Round-1X1 mm-4 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type 4-Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
solitaire-engagement-rings