Real Pink Tourmaline Heart Pendant with Diamond Bail

Sale price $914.00 Regular price $1,027.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Representing timeless love and eternal togetherness is this heart pendant that features a pink tourmaline in the center set on a metal motif. The delightful hue of the pink tourmaline is accentuated by the unending sparkle of Diamond that embellishes the bale. Exuding a touch of romance, the solitaire pendant makes a great anniversary present for your spouse. Wear it long or short considering your personal style or preference.

Product Information
SKU SHP-PENDANT032214942
Metal Weight 3.90 gm (Approximate)
Total Stone Weight 0.94 Carat (Approximate)
PINK TOURMALINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Heart-6X6 mm-1 Pcs
Color Pink
Cut Brilliant
Shape Heart
Setting Type 3-Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.04 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-0.90X0.90 mm-1 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1.20X1.20 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 3-Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
pink-tourmaline-necklaces