Real Diamond Lotus Flower Drop Earring for Cartilage Piercing

0
Regular price $1,081.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Soft floral charm meets sparkling elegance in this beautifully crafted Diamond Lotus Earring. Designed to add a gentle glow to your everyday style, it captures the peaceful beauty of a blooming lotus in a way that feels both modern and meaningful. At the center of the piece lies a graceful lotus motif made from marquise cut real diamonds that shine with HI color and SI clarity. Just below it, a tiny round diamond drop adds a little movement and sparkle, giving the Flower Helix Earring a airy look every time you wear it. Made for multiple piercings, it fits comfortably on the helix, cartilage, or upper lobe, letting you style it however you like, wear it solo for a dainty look or pair it with other earrings for a stacked style. The flat back closure keeps it secure and comfortable all day long, so you can enjoy its shine without any discomfort. This Diamond Cartilage Earring is crafted with fine attention to detail, making it a lovely addition to both simple and dressy outfits. Whether you want something meaningful to wear every day or a special piece that adds subtle elegance to your look, this lotus piercing brings a gentle sparkle that feels soothing, stylish, and easy to love.

Product Information
SKU SHP-BODYJ0921397158
Metal Weight 0.50 gm (Approximate)
Total Stone Weight 0.18 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.18 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-3 Pcs
Round-0.80X0.80 mm-6 Pcs
Round-1.30X1.30 mm-1 Pcs
Color HI
Cut Brilliant
Shape Marquise, Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
cartilage-earrings