Princess Cut Moissanite Floral Engagement Ring for Women

Regular price $609.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Engagement Ring with Princess Cut Moissanite

This engagement ring blends gemstone brilliance with nature-inspired design through a carefully crafted floral setting. At the center of the ring sits a princess cut moissanite gemstone, known for its square shape and crisp faceting. The structured geometry of the princess cut creates a striking focal point while maintaining a balanced and elegant appearance.

Floral engagement rings are often chosen for their graceful symbolism and artistic design. In this piece, the gemstone is framed within a floral motif that introduces delicate detail while keeping the center stone as the primary visual highlight.

Nature-Inspired Floral Setting

The floral setting is designed to resemble the shape and arrangement of petals around the central gemstone. This structure brings softness and organic character to the ring while complementing the sharp symmetry of the princess cut moissanite.

Designs inspired by natural forms are valued for their ability to combine elegance with individuality. The floral motif adds dimension to the ring, giving the overall piece a refined appearance that stands out while remaining timeless.

The Appeal of Princess Cut Moissanite

Princess cut gemstones are admired for their square outline and structured faceting pattern. This cut allows light to interact with the stone’s surface from multiple angles, creating a lively and balanced appearance within the design.

Moissanite is created without traditional mining, though environmental impact can vary depending on production and energy sources. Its clarity and reflective qualities make it a popular choice for engagement rings that highlight brilliance and geometric precision.

A Distinctive Engagement Ring with Elegant Detail

The combination of a princess cut gemstone and floral-inspired setting gives this ring both structure and artistic character. The center moissanite remains the focal point, while the surrounding design introduces graceful detail that enhances the overall composition.

For those seeking an engagement ring that blends gemstone brilliance with nature-inspired craftsmanship, this floral moissanite design offers a refined and expressive choice.

Product Information
SKU SHP-RINGS082214349
Metal Weight 2.60 gm (Approximate)
Center Stone Weight 0.79 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 13 Pieces
Total Weight 1.15 Carat (Approximate)
Dimension(approx) Princess Cut-5X5 mm-1 Pcs
Round-2X2 mm-4 Pcs
Round-1.20X1.20 mm-8 Pcs
Color White
Cut Brilliant
Shape Princess Cut, Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-rings

FAQs About: Princess Cut Moissanite Floral Engagement Ring for Women

What is a princess cut gemstone?
A princess cut gemstone has a square shape with sharp corners and faceted surfaces designed to reflect light. It is widely appreciated for its structured appearance and balanced brilliance.
What does a floral engagement ring design represent?
Floral engagement rings are inspired by natural petal shapes and botanical patterns. These designs are often chosen for their graceful appearance and symbolic connection to growth and beauty.
What is moissanite?
Moissanite is a gemstone created in controlled laboratory conditions. It is valued for its brilliance and clarity and is produced without traditional mining.
Why is moissanite used in engagement rings?
Moissanite is often selected for engagement rings because of its reflective qualities and elegant appearance. Its brightness allows the gemstone to stand out within many ring designs.
Can this ring be paired with a wedding band?
Yes. Engagement rings with decorative settings can often be paired with complementary wedding bands depending on the band style and how closely it sits beside the ring.