Pear Cut Lab Grown Diamond Flower Stud Earrings with Screw Back

Sale price $1,157.00 Regular price $1,330.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Add the timeless charm of natures delicate beauty to your look with these Diamond Flower Earrings, designed to bring a soft sparkle to every moment. Each Earring features a Flower Motif, with shimmering pear shaped lab grown Diamond stones set in prong setting at the center that catch the light from every angle. The combination of elegant simplicity and subtle sparkle makes them perfect for both everyday wear and special occasions, offering a touch of sophistication that feels effortlessly graceful. Secured with Screw Back Closure, these Lab Grown Diamond Stud Earrings provide all-day comfort and confidence, whether you are at work, enjoying a casual outing or attending a celebration. Their versatile design pairs beautifully with a wide range of outfits, making them an essential accessory for anyone who loves understated glamour. Presented in a charming jewelry box, these Diamond Floral Earrings for Women make a thoughtful and memorable gift for birthdays, anniversaries, holidays or simply to show someone you care. These Lab Made Diamond Studs are a sparkling reminder that the smallest details can leave the biggest impression and a timeless piece she will treasure for years to come.

Product Information
SKU SHP-EARRINGS062610016
Metal Weight 1.92 gm (Approximate)
Total Stone Weight 2.66 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 2.66 Carat (Approximate)
Dimension(approx) Pear-3X5 mm-14 Pcs
Color E-F
Cut Brilliant
Shape Pear
Setting Type Prong-Setting
Quality Grade VS
View More