Nature Inspired Moissanite Flower Engagement Ring with Certificate

Sale price $628.00 Regular price $722.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Nature-Inspired Expression of Commitment

This moissanite flower engagement ring is created for those who prefer a design that feels organic and symbolic rather than traditional. Inspired by natural forms, it offers a softer, more expressive interpretation of an engagement ring.

The floral motif introduces a sense of individuality, making it a thoughtful choice for someone who values meaningful design with visual character.

Design That Reflects Natural Harmony

The flower-inspired setting is carefully structured to create balance and visual flow. Each element is arranged to echo the symmetry found in nature while maintaining a refined, wearable profile.

This approach allows the ring to stand out without appearing overly ornate, offering a design that feels both artistic and composed.

A Distinctive Center with Everyday Versatility

The moissanite centerpiece brings brightness and clarity to the design, enhancing the overall floral arrangement. Its placement ensures the ring remains visually engaging while still suitable for regular wear.

The structure of the ring is designed to maintain comfort while preserving the intricacy of the floral details.

Moissanite with a Modern Perspective

Moissanite is created without traditional mining, offering an alternative approach to gemstone sourcing. It delivers a luminous appearance while aligning with evolving preferences in jewelry choices.

Environmental impact varies by production and energy source, making it a consideration based on individual priorities.

A Design Meant to Feel Personal Over Time

With its nature-inspired concept and balanced construction, this ring is intended to remain meaningful beyond trends. It offers a combination of design detail and everyday practicality, making it suitable for long-term wear.

For those seeking a ring that carries symbolic value as well as distinctive design, this piece provides a refined and thoughtful option.

Product Information
SKU SHP-RINGS0821202995
Width 7.5 mm
Height 14 mm
Weight 4.50 gm (Approximate)
Center Stone Weight 1.36 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 31 Pieces
Total Weight 1.74 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-6 Pcs
Round-1.10X1.10 mm-6 Pcs
Round-1.30X1.30 mm-12 Pcs
Round-1.50X1.50 mm-6 Pcs
Round-7X7 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-engagement-rings

Faq About: Nature Inspired Moissanite Flower Engagement Ring with Certificate

What makes a flower engagement ring different from classic designs?
Flower engagement rings feature nature-inspired elements that create a more artistic and symbolic look compared to traditional solitaire styles.
Is moissanite suitable for everyday wear?
Moissanite is durable and suitable for daily wear when handled with care, making it a practical choice for engagement rings.
Does the floral design affect comfort?
The ring is designed to balance detail with wearability, allowing it to feel comfortable while maintaining its decorative structure.
Can this ring be paired with a wedding band?
Yes, it can be paired with a wedding band, though the floral design may influence the style and fit of the band chosen.
Does the ring come with certification?
Yes, this ring includes certification, providing confirmation of the stone’s authenticity.
How should a detailed ring like this be maintained?
Regular cleaning and careful handling help preserve the appearance of intricate designs and keep the ring looking its best over time.