Nature Inspired Citrine Leaf Earrings with Diamond

0
Regular price $1,011.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Indulge in a touch of nature inspired elegance with these adorable Leaf Earrings, a stunning blend of warm color, delicate sparkle and graceful design. At the center of each Leaf motif sits a 5 mm Round Shape Citrine set in Prong Setting, glowing with a golden hue that instantly brightens your look. Surrounding it, dainty Diamond stones are studded over the leaf motif, adding a soft shimmer that brings the entire design to life. The combination feels fresh and feminine, perfect for those who love jewelry that reflects the charm of the natural world. Crafted with Secure Screw Back Closure, these Citrine Stud Earrings stay comfortably in place whether you are heading to brunch, a special event or simply elevating your everyday style. They pair effortlessly with flowy dresses and elegant casual outfits, making them a versatile addition to any jewelry collection. These Real Citrine Diamond Earrings arrive in a signature jewelry box, ready to gift and guaranteed to make a memorable impression. Ideal for birthdays, holidays, anniversaries or a thoughtful surprise, these November Birthstone Citrine Studs offer a unique blend of sophistication and the beauty of nature. A perfect choice for anyone who wants to carry a little sunshine and sparkle wherever they go.

Product Information
SKU SHP-EARRINGS082310486
Metal Weight 1.50 gm (Approximate)
Total Stone Weight 1.37 Carat (Approximate)
CITRINE INFORMATION
No.of Stones 2 Pieces
Total Weight 1.02 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Yellow
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
citrine-earrings