Nature Inspired 2 Carat Lab Grown Diamond Pear Engagement Ring with IGI Certificate

Sale price $1,227.00 Regular price $1,410.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of nature, this Lab Grown Diamond Engagement Ring is a wonderful piece of jewelry for any special occasion. Crafted with great attention to detail, it features a 2 Carat Pear Shape Lab Grown Diamond in a Claw Setting, making it a stunning choice for the lady who wants to shine with a style that suits her personality. The Nature Inspired leaf detailing gracefully frames the center stone with soft, flowing shapes adorned with dainty diamonds that reflect the natural elegance of leaves. This Nature Inspired Engagement Ring is a classic trend that is cherished even by royalty. It showcases intricate designs that look like a stunning piece of jewelry with delicate petals. It captures the beauty of nature, giving off a sense of romance and femininity, making it the perfect Teardrop Engagement Ring. It is also associated with love, growth, and new beginnings, making it a great motif for this Pear Solitaire Engagement Ring, which is often given as a symbol of love. Each gemstone is ethically sourced and lab grown, offering an eco-friendly and sustainable choice without compromising on quality. This beautiful 2 Carat Diamond Ring will be shipped to you in a premium-quality jewelry box with an IGI Gemstone Authenticity Certificate to give a trustworthy experience when you shop with us.

Product Information
SKU SHP-RINGS072610188
Metal Weight 2.32 gm (Approximate)
Center Stone Weight 2.00 Carat (Approximate)
LAB GROWN DIAMOND(IGI) INFORMATION
No.of Stones 1 Pieces
Total Weight 2.00 Carat (Approximate)
Dimension(approx) Pear-11X7 mm-1 Pcs
Color E
Cut Brilliant
Shape Pear
Setting Type Claw-Set
Quality Grade VS1
LAB GROWN DIAMOND INFORMATION
No.of Stones 8 Pieces
Total Weight 0.05 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-2 Pcs
Round-1.40X1.40 mm-2 Pcs
Round-1X1 mm-4 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade VS
View More