Natural Tahitian Pearl Bridal Infinity Drop Jewelry Set with Moissanite

Regular price $1,376.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Tahitian Pearl Bridal Jewelry Set

This bridal jewelry set features natural Tahitian pearls paired with moissanite accents in an elegant infinity-inspired drop design. The set combines the depth and luster of Tahitian pearls with the brightness of moissanite to create a balanced and refined appearance.

Tahitian pearls are admired for their distinctive tones and natural luster, giving pearl jewelry a unique visual character. Their rich appearance makes them a popular choice for formal occasions and bridal jewelry collections.

Infinity-Inspired Drop Design

The design incorporates the infinity motif, a symbol often associated with continuity and enduring connection. The flowing structure of the infinity shape introduces movement within the design while maintaining a graceful silhouette.

Drop-style jewelry naturally draws attention through its vertical structure, allowing the gemstones and pearls to be displayed prominently while maintaining balance within the overall composition.

Moissanite Accents for Brilliance

Moissanite gemstones are included in the design to add brilliance alongside the pearls’ smooth luster. The gemstone’s light-reflecting qualities create sparkle that complements the deeper tones of Tahitian pearls.

Moissanite is created without traditional mining, though environmental impact can vary depending on the production process and energy sources used.

A Coordinated Bridal Jewelry Style

Jewelry sets provide a coordinated appearance by pairing complementary pieces within a single design theme. The infinity motif and drop structure help create visual harmony between the pearls and gemstone accents.

For bridal occasions and formal celebrations, a pearl jewelry set offers a classic and sophisticated style that blends natural gemstones with elegant design elements.

Product Information
SKU SHP-PENDANT122036267
Length 30.7 mm
Width 11.4 mm
Weight 5.60 gm (Approximate)
TAHITIAN PEARL INFORMATION
No.of Stones 3 Pieces
Total Weight 23.68 Carat (Approximate)
Dimension(approx) Round-10X10 mm-1 Pcs
Round-8X8 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
MOISSANITE INFORMATION
No.of Stones 55 Pieces
Total Weight 0.64 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-6 Pcs
Round-1.10X1.10 mm-9 Pcs
Round-1.20X1.20 mm-14 Pcs
Round-1.30X1.30 mm-2 Pcs
Round-1.40X1.40 mm-3 Pcs
Round-1.50X1.50 mm-1 Pcs
Round-1.60X1.60 mm-5 Pcs
Round-1X1 mm-7 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade D-VS1
View More

Product Parent Collection Handle
tahitian-pearl-necklaces

FAQs About: 24.25 CT Natural Tahitian Pearl Bridal Infinity Drop Jewelry Set with Moissanite

What makes Tahitian pearls different from other pearls?
Tahitian pearls are known for their darker tones and natural luster. Their unique colors and surface appearance distinguish them from traditional white pearls.
What does the infinity symbol represent in jewelry?
The infinity symbol is often associated with continuity, lasting bonds, and enduring connection, which makes it a popular design element in meaningful jewelry pieces.
What is moissanite used for in jewelry?
Moissanite is valued for its brilliance and reflective qualities. It is commonly used in jewelry designs where sparkle and light reflection are desired.
What is a bridal jewelry set?
A bridal jewelry set typically includes coordinated pieces designed to be worn together for formal occasions such as weddings or special celebrations.
Why are pearl jewelry sets popular for weddings?
Pearl jewelry sets are often chosen for weddings because pearls are associated with elegance and timeless style, making them suitable for formal and ceremonial occasions.