Natural Ruby Flower Promise Ring with Diamond

Regular price $1,371.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Symbol of Commitment

The Natural Ruby Flower Promise Ring with Diamond is designed to express affection through a delicate floral silhouette. At its center, a natural ruby brings vibrant red color, while diamond accents enhance the overall brilliance and structure of the flower-inspired design.

Design & Setting Details

The floral motif creates a soft, romantic profile that feels meaningful yet refined. The ruby forms the focal point, with diamonds arranged to complement the petal-like structure. The setting is crafted to hold each stone securely while maintaining an elegant and wearable balance suitable for a promise ring.

Stone Character & Wear Considerations

Natural ruby is valued for its rich red hue and symbolic association with love and devotion. Diamond accents add contrast and brightness to the design. With appropriate care, this ring can be worn regularly. Removing it during high-impact activities and avoiding harsh chemicals helps preserve both the stones and the setting.

High-Level Features Buyers Consider

  • Natural ruby center: vibrant red tone with timeless appeal.
  • Diamond accents: added brilliance and refined detailing.
  • Floral-inspired design: romantic silhouette suited for promise occasions.
  • Metal options available: choose your preferred metal directly on the product page.
Product Information
SKU SHP-RINGS092212185
Width 9 mm
Height 6.8 mm
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.56 Carat (Approximate)
RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.13 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 50 Pieces
Total Weight 0.43 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-8 Pcs
Round-0.90X0.90 mm-8 Pcs
Round-1.10X1.10 mm-8 Pcs
Round-1.20X1.20 mm-8 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-2 Pcs
Round-1X1 mm-8 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
ruby-engagement-rings
Is the ruby in this ring natural?
Yes, this ring features a natural ruby center stone as listed in the product specifications.
Does this ring include diamonds?
Yes, the design includes diamond accents. Please refer to the product detail table for complete stone information.
Is this ring suitable as a promise ring?
Yes, the floral design and ruby center make it a meaningful choice for expressing commitment or a special promise.
Can this ring be worn daily?
With proper care, the ring can be worn regularly. It is recommended to remove it during strenuous activities to help protect the stones and setting.
How should I clean this ruby and diamond ring?
Clean gently using mild soap and warm water with a soft cloth or brush. Avoid harsh chemicals and store the ring separately when not in use.