Natural Peridot Flower Cluster Engagement Ring

Sale price $514.00 Regular price $577.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Celebrate a relationship in bloom with this Natural Peridot Flower Cluster Engagement Ring. Seven vivid green peridots come together in a floral arrangement, creating a nature-inspired centerpiece with color and dimension across the finger. The flower motif gives this gemstone engagement ring a meaningful connection to growth and new beginnings, making it a distinctive choice for proposals, anniversaries, and personal milestones.

1.12 Carat Natural Peridot Flower Cluster Engagement Ring

The ring is set with seven round natural peridots totaling approximately 1.12 carats. Each gemstone measures about 3 x 3 mm and combines a brilliant cut with AAA quality and a prong setting. Crafted in 92.5 sterling silver, the ring has an approximate metal weight of 1.84 grams, a width of 11.8 mm, and a height of 4.5 mm.

What Makes This Peridot Flower Cluster Ring Special

  • Seven round green peridot gemstones arranged in a flower cluster.
  • Approximately 1.12 carats of total peridot weight.
  • Each stone measures approximately 3 x 3 mm.
  • AAA quality peridots with brilliant-cut faceting.
  • Prong settings define each gemstone within the floral arrangement.
  • 11.8 mm ring width creates noticeable coverage across the finger.
  • Crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 1.84 grams.

These proportions give the ring a clearly defined floral presence while keeping the seven matching peridots as the central visual focus.

Meaning Behind the Natural Peridot Flower Engagement Ring

The clustered flower design gives the ring a natural association with growth, joy, and a relationship continuing to flourish. Instead of relying on a single center gemstone, seven matching round peridots work together to form the focal point, creating a more expressive alternative to a traditional solitaire. The fresh green color and botanical silhouette make the design especially fitting for someone who prefers colorful, nature-inspired engagement jewelry.

Natural Peridot Ring Authenticity & Craftsmanship

Rosec Jewels crafts this peridot ring with attention to gemstone placement, secure prong settings, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Each piece also goes through stone inspection, setting security review, and finishing inspection before dispatch, with care guidance provided to support responsible long-term wear.

Styling the Peridot Flower Cluster Engagement Ring

The 11.8 mm floral top gives the green peridot cluster noticeable presence from above, while the sterling silver band provides a cool-toned frame around the gemstones. Wear it as a colorful engagement ring, a floral statement piece, or a meaningful gemstone gift. Its nature-inspired profile pairs easily with understated silver-toned jewelry when you want the flower cluster to remain the main focus.

Product Information
SKU SHP-RINGS0821190474
Width 11.8 mm
Height 4.5 mm
Metal Weight 1.84 gm (Approximate)
Total Stone Weight 1.12 Carat (Approximate)
PERIDOT INFORMATION
No.of Stones 7 Pieces
Total Weight 1.12 Carat (Approximate)
Dimension(approx) Round-3X3 mm-7 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
peridot-rings

FAQs About: Natural Peridot Flower Cluster Engagement Ring

How many peridot stones are in this flower cluster engagement ring?

The ring contains seven round natural peridot stones with an approximate combined weight of 1.12 carats. They are arranged together to create the flower-shaped centerpiece.

What size and quality are the peridot gemstones?

Each green peridot measures approximately 3 x 3 mm. The gemstones are round, brilliant cut, and graded AAA quality.

What setting is used for the peridot flower cluster?

The seven peridot gemstones are secured in prong settings, allowing each round stone to remain individually defined within the floral arrangement.

Why choose a peridot flower ring for an engagement?

The floral cluster offers a colorful alternative to a traditional solitaire engagement ring. Its blooming-flower design can represent growth and a relationship continuing to flourish, making it meaningful for proposals and commitment milestones.

What metal is used for this natural peridot engagement ring?

The confirmed ring is crafted in 92.5 sterling silver and selected yellow or white gold options in 10K, 14K, and 18K with an approximate metal weight of 1.84 grams. It measures approximately 11.8 mm in width and 4.5 mm in height.

Does this peridot ring come with a Certificate of Authenticity?

Rosec Jewels offers a Certificate of Authenticity with its jewelry for added purchase confidence. Pieces also go through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for a natural peridot flower cluster ring?

Clean the ring gently with mild soap, lukewarm water, and a soft cloth, then dry it carefully. Avoid harsh chemicals, abrasive surfaces, and strong impacts, store the ring separately when not worn, and periodically check the prong settings to help keep the peridot stones secure.