Natural Half Carat Emerald Star Pendant Necklace for Women

Regular price $1,238.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Twinkling with charm and playful elegance, this Star Pendant Necklace is made to shine wherever you go. At the center of the Star motif rests a vibrant 5 mm Round Shape Emerald set in Prong Setting, glowing with a rich green hue that instantly draws attention. The star design adds a fun yet meaningful touch, symbolizing hope, guidance and light, while the natural AAA Quality Emerald brings a sense of freshness and calm. This Emerald Pendant Necklace is easy to style and adds a subtle statement to any outfit. This Womens Emerald Necklace is designed for everyday wear, yet special enough for celebrations and memorable moments. This May Birthstone Necklace comes beautifully packed in a jewelry box, making it ready to gift for birthdays, graduations, anniversaries or simply as a thoughtful surprise. It is a little reminder to always shine bright.

Product Information
SKU SHP-PENDANT042170735
Length 18.7 mm
Width 12.6 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.50 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
emerald-necklace