Natural Garnet Diamond Flower Engagement Ring with Split Shank

Sale price $963.00 Regular price $1,082.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Engagement Design with Character

The natural garnet diamond flower engagement ring with split shank is designed for those who appreciate expressive color paired with detailed craftsmanship. The floral-inspired arrangement highlights the deep tone of the natural garnet, while diamond accents introduce balanced brilliance. This composition creates a ring that feels distinctive yet refined for engagement wear.

Flower Motif & Split Shank Structure

The flower setting frames the garnet center stone with diamond accents, forming a petal-like outline that enhances visual dimension. The split shank band divides as it approaches the center, adding structural interest and distributing the design evenly across the finger. This combination offers both decorative detail and a supportive setting for the centerpiece.

Natural Garnet & Diamond Characteristics

Crafted with a natural garnet center stone, this ring showcases a rich hue that stands apart from traditional engagement gemstones. Garnet offers good durability for fine jewelry, though it benefits from mindful care during daily wear. Diamond accents contribute additional sparkle and long-term resilience to the overall design.

High-Level Features

  • Natural garnet center stone in a floral-inspired setting.
  • Diamond accents enhancing brilliance and contrast.
  • Split shank band for added structure and visual interest.
  • Available in multiple precious metal options.
Product Information
SKU SHP-RINGS0821221723
Width 3.8 mm
Height 7 mm
Metal Weight 2.52 gm (Approximate)
Total Stone Weight 0.66 Carat (Approximate)
GARNET INFORMATION
No.of Stones 1 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
garnet-engagement-rings

FAQs About: Natural Garnet Diamond Flower Engagement Ring with Split Shank

Is the center stone a natural garnet?
Yes. The product specifies a natural garnet center stone. Please refer to the product specification tables for detailed information.
What is the benefit of a split shank design?
A split shank band divides as it approaches the center stone, adding structural detail and enhancing the overall visual balance of the ring.
Is this ring suitable for everyday wear?
Garnet offers good durability for fine jewelry, but mindful care is recommended to help maintain its appearance during daily wear.
What metal options are available?
Available metal selections are listed in the product options and detailed in the product specification tables on the page.
Are the diamonds natural?
The product specifies diamond accents. Please review the product specification tables for clarity on diamond details.
How should I care for this ring?
Clean gently with mild soap and lukewarm water using a soft brush. Avoid harsh chemicals and store separately to help preserve the gemstone and setting.