Natural Emerald and Diamond Vintage Inspired Engagement Ring For Her

Regular price $1,292.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Nature's delicate beauty blooms in this Vintage Inspired Emerald Ring, a piece that captures elegance and meaning in every detail. It features a 5 MM round cut lab created emerald of AAAA quality that shines brightly in claw setting. Surrounding the central stone, sparkling HI-SI quality diamonds form a floral halo, enhancing the emerald's vibrant green color and creating a eye-catching effect. The vintage inspired floral motif blends classic sophistication with a touch of modern artistry, ensuring the Emerald and Diamond Ring stands out as both meaningful and beautiful. Crafted in precious metal with careful attention to detail, this Antique Flower Ring combines durability with elegance. Its design is versatile enough to wear daily or for formal events, making it a treasured piece for years to come. Presented in a luxurious jewelry box and accompanied by a certificate of authenticity, this Emerald Engagement Ring makes a thoughtful gift or a cherished addition to your collection. With its rich green hue, sparkling diamonds, and graceful floral design, it embodies timeless beauty and the enduring spirit of love, making it a perfect symbol of commitment and devotion.

Product Information
SKU SHP-RINGS0821169251
Width 4.5 mm
Height 9.2 mm
Metal Weight 1.70 gm (Approximate)
Total Stone Weight 0.55 Carat (Approximate)
EMERALD INFORMATION
No.of Stones 1 Pieces
Total Weight 0.50 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Green
Cut Brilliant
Shape Round
Setting Type 4-Claw-Prong-Diagonal-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 12 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-8 Pcs
Round-1X1 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 4-Claw-Prong-Diagonal-Setting
Quality Grade SI
View More

Product Parent Collection Handle
emerald-rings