Natural Diamond Cross Pendant Necklace for Women

Regular price $1,519.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbol Rooted in Meaning

This natural diamond cross pendant necklace is designed for those who value both symbolism and refined simplicity. The cross motif offers a timeless expression of faith, identity, or personal significance, presented in a clean and composed form.

It serves as a subtle yet meaningful piece that integrates effortlessly into everyday wear.

Balanced Design with Purpose

The structure of the pendant focuses on proportion and clarity, ensuring that the cross silhouette remains defined without excess detailing. This approach allows the piece to maintain a sense of calm elegance while still drawing attention through its thoughtful composition.

The result is a design that feels intentional and enduring.

Setting That Enhances Simplicity

The diamonds are arranged to complement the shape rather than overpower it, allowing the overall design to remain cohesive. This creates a refined visual rhythm that highlights the form while preserving a minimal aesthetic.

It ensures that the pendant remains versatile across different styling choices.

Natural Diamond Character

Natural diamonds are valued for their enduring presence and suitability for regular wear. Each stone contributes to a subtle brilliance that enhances the design without appearing excessive.

This makes the piece appropriate for both daily use and meaningful occasions.

Versatile for Everyday Expression

Designed to transition seamlessly between casual and formal settings, this necklace can be worn alone or layered with other pieces. Its understated nature allows it to complement a wide range of personal styles.

This adaptability ensures it remains relevant beyond a single occasion.

Product Information
SKU SHP-PENDANT092021304
Length 26.5 mm
Width 11.2 mm
Metal Weight 3.10 gm (Approximate)
Total Stone Weight 0.62 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 13 Pieces
Total Weight 0.62 Carat (Approximate)
Dimension(approx) Round-2X2 mm-13 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-necklaces

Faq About: Natural Diamond Cross Pendant Necklace for Women

Is this necklace suitable for everyday wear?
Yes, its balanced and minimal design makes it suitable for daily wear across different settings.
Can this pendant be layered with other necklaces?
The simple structure allows it to pair well with other necklaces without creating visual clutter.
Is the design suitable for gifting?
Its symbolic meaning and refined appearance make it a thoughtful option for various gifting occasions.
Will the pendant feel heavy when worn?
The design focuses on maintaining a comfortable feel, allowing it to be worn for extended periods with ease.
How should I care for this necklace?
Gentle cleaning and proper storage will help maintain its shine and overall condition over time.
Does this necklace match different outfits?
Its understated design allows it to complement both casual and formal attire with ease.