Natural Diamond Cat Stud Earrings with Screw Back

Regular price $2,343.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Designed for the one who carries a little charm, confidence, and personality into every room, these Natural Diamond Cat Stud Earrings bring playful meaning into fine jewelry. The feline-inspired silhouette is shaped with a graceful long tail, a polished metal head and fur detail, and a diamond-studded body that gives the design its lively sparkle. A 4 mm heart shape diamond adds a sweet focal point, while round diamonds brighten the center and tail for a look that feels expressive, personal, and full of character.

With secure screw backs and a petite stud profile, this pair is made for cat lovers, thoughtful gifting, and everyday styling with a distinctive twist. Whether chosen as a birthday surprise, a personal treat, or a meaningful gift for someone whose pet holds a special place in their heart, these earrings offer a joyful blend of sentiment and shine.

Natural Heart Diamond Cat Stud Earrings with Round Diamond Accents

These cat stud earrings are crafted with natural diamonds in a prong setting, combining heart shape and round diamond accents within a sculpted feline design. The pair carries approximately 0.64 carat total diamond weight across 22 stones, with HI color and SI quality grade diamonds. The earrings measure approximately 12.5 mm in length and 7.4 mm in width, giving them enough presence to be noticed while remaining easy to wear as everyday studs.

What Makes This Special

  • Cat-inspired stud earring design with a long-tail silhouette and expressive feline character.
  • Set with 22 natural diamonds totaling approximately 0.64 carat.
  • Features two 4 x 4 mm heart shape diamonds as the signature focal stones.
  • Includes round diamond accents measuring approximately 0.90 x 0.90 mm and 1.20 x 1.20 mm.
  • Diamonds are arranged in a prong setting for a defined, light-catching finish.
  • Designed with screw backs for a secure, comfortable stud earring fit.
  • Available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Why Choose This Design

The heart shape diamonds bring a soft, affectionate detail to the cat motif, making the design feel more personal than a standard stud earring. Round diamonds add brightness through the center and tail, creating movement and sparkle without overwhelming the playful shape. The prong setting allows the diamond accents to remain clearly defined, while the screw back closure offers added confidence for regular wear.

Its compact 12.5 mm by 7.4 mm size gives the earrings a wearable scale: expressive enough to show personality, yet refined enough to pair with everyday outfits, workwear, and special-occasion looks. The choice of sterling silver and multiple gold options also allows the design to match different style preferences and gifting budgets.

Design Meaning

A cat motif often speaks to independence, affection, intuition, and quiet confidence. In this design, that symbolism is softened with heart shape diamonds, giving the earrings an added sense of love and emotional connection. For a devoted cat lover, the pair becomes more than an accessory; it feels like a small tribute to companionship, individuality, and the special bond shared with a beloved pet.

The long-tail silhouette adds a spirited, slightly whimsical touch, while the diamonds bring the design into a fine jewelry space. It is a thoughtful way to celebrate personal style, a pet-inspired memory, or a playful side that deserves to shine.

Authenticity & Craftsmanship

Each pair is carefully crafted with attention to the feline outline, secure diamond placement, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase. Before dispatch, the earrings go through stone inspection, setting security review, and finishing inspection to help ensure the diamonds are properly placed and the final piece is ready to wear. Care guidance is also part of the customer support experience, helping you preserve the shine and detail of your jewelry over time.

Style and Wearability

These diamond cat studs bring a charming point of interest to the ear without feeling oversized. From the front, the heart and round diamond layout gives the feline shape a bright, expressive sparkle; from the side, the stud profile keeps the design neat and easy to style. They can be worn alone for a playful signature look or paired with simple hoops, diamond studs, or delicate necklaces for a layered jewelry moment.

The secure screw back design makes them a practical choice for regular wear, while the cat theme makes them especially giftable for birthdays, holidays, pet lovers, milestone celebrations, or a meaningful “just because” surprise.

Product Information
SKU SHP-EARRINGS082310536
Length 12.5 mm
Width 7.4 mm
Weight 1.52 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 22 Pieces
Total Weight 0.64 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-2 Pcs
Round-0.90X0.90 mm-18 Pcs
Round-1.20X1.20 mm-2 Pcs
Color HI
Cut Brilliant
Shape Heart, Round
Setting Type Prong-Setting
Quality Grade SI
View More

FAQs About: Natural Diamond Cat Stud Earrings with Screw Back

What makes these diamond cat stud earrings a meaningful gift?

These earrings are especially meaningful for someone who loves cats or enjoys jewelry with personality. The cat silhouette adds a playful, personal touch, while the heart shape diamonds bring a feeling of affection and sentiment, making the pair suitable for birthdays, holidays, pet-inspired gifts, or a thoughtful surprise.

What diamonds are used in these cat stud earrings?

The earrings are set with natural diamonds in HI color and SI quality grade. The design includes 22 diamonds in total, with an approximate total diamond weight of 0.64 carat. The diamond layout includes heart shape diamonds and round diamond accents.

What is the setting style of these earrings?

The diamonds are placed in a prong setting. This setting style helps define the heart and round diamond details while allowing the stones to catch light across the cat-inspired design.

Do these earrings include both heart and round diamonds?

Yes. The design includes two heart shape diamonds measuring approximately 4 x 4 mm, along with round diamond accents measuring approximately 0.90 x 0.90 mm and 1.20 x 1.20 mm. Together, these stones create the expressive feline shape and sparkling tail detail.

Which metal options are available for these diamond cat earrings?

These earrings are available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. This range allows you to choose the metal tone and purity that best suits your style or gifting preference.

Are these cat stud earrings suitable for daily wear?

Yes, the stud silhouette and screw back closure make them suitable for regular wear. Their approximate 12.5 mm length and 7.4 mm width give the design a noticeable yet comfortable presence for everyday outfits, workwear, and casual styling.

Do these earrings come with an authenticity certificate?

Yes. Rosec Jewels offers a Certificate of Authenticity with the product. Each pair also goes through stone inspection, setting security review, and finishing inspection before dispatch.