Natural Diamond Butterfly Ring with Certificate

Regular price $1,763.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Inspired by the beauty of love in motion, this Diamond Butterfly Ring tells a story that feels deeply romantic. Designed in a modern wrap style, it gently curves around the finger, creating a look that is both graceful and unique. On one end, a delicate Butterfly motif sparkles with dainty Diamond stones, symbolizing growth, transformation and the joy of finding someone who makes you feel alive. On the other end, a 4 mm Round Diamond shines, representing the strength of true love. This Diamond Wrap Ring feels like a promise whispered, made for moments that do not need grand gestures to feel special. Every detail is thoughtful, from the HI-SI Quality Diamond stones that catch the light effortlessly to the elegant design that stands out. Presented in a signature jewelry box and available in various ring sizes, this Natural Diamond Ring is ready to become part of her everyday story. A beautiful way to express eternal love, this Diamond Ring for Women feels modern and full of heart.

Product Information
SKU SHP-RINGS042157127
Width 2.8 mm
Height 12.5 mm
Metal Weight 2.50 gm (Approximate)
Total Stone Weight 0.48 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 22 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-1 Pcs
Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-7 Pcs
Round-1.30X1.30 mm-4 Pcs
Round-1.80X1.80 mm-1 Pcs
Round-1X1 mm-4 Pcs
Round-4X4 mm-1 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-rings