Natural Blue Sapphire and Diamond Leaf Dangle Earrings

Regular price $2,577.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your style with these nature inspired Blue Sapphire Dangle Earrings. The earrings feature marquise shape blue sapphires and round cut Diamond stones set in a beautiful leaf motif. The dangle design adds a touch of movement, making these Blue Sapphire and Diamond Earrings perfect for those who appreciate unique and eye-catching jewelry. The high quality metal and stones adds a luxurious touch, making these Leaf Earrings ideal for September born women. Whether worn for special occasions or as an everyday accessory, these Fish Hook Earrings are sure to make a statement. With their beautiful blue color, nature inspired design, and high quality materials, they are the perfect choice for anyone looking to add a touch of glamour and sophistication to their look. So why wait? Adorn yourself with these Nature Inspired Earrings and let your style blossom.

Product Information
SKU SHP-EARRINGS052210031
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 2.57 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 12 Pieces
Total Weight 2.40 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-12 Pcs
Color Blue
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.17 Carat (Approximate)
Dimension(approx) Round-1X1 mm-28 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-earrings