Natural Blue Sapphire and Diamond Eternity Wedding Band

Sale price $1,223.00 Regular price $1,344.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Crafted to embody refinement and everlasting beauty, this Blue Sapphire Eternity Band is a remarkable expression of elegance and artistry. Designed with a graceful sequence of precious gemstones and dazzling accents, the ring showcases a sophisticated alternating arrangement of round cut Blue Sapphire and Diamonds in Prong Setting that creates a captivating sense of balance and brilliance. The Full Eternity Ring is thoughtfully created for individuals who appreciate fine craftsmanship and timeless jewelry styles. Its seamless pattern symbolizes continuity, love, and enduring commitment, making it an ideal choice for celebrating meaningful milestones, anniversaries, engagements, or treasured personal moments. Expertly crafted with attention to quality and precision, this Sapphire Diamond Wedding Band offers a graceful blend of sophistication and modern elegance. Comfortable enough for everyday wear yet luxurious enough for formal occasions, this Eternity Wedding Band is a versatile addition to any jewelry collection. Whether presented as a heartfelt gift or chosen as a personal statement piece, this exquisite Blue Sapphire Anniversary Ring carries a sense of sentiment and prestige that never goes out of style.

Product Information
SKU SHP-RINGS082215939
Width 3 mm
Height 2.2 mm
Metal Weight 1.84 gm (Approximate)
Total Stone Weight 2.19 Carat (Approximate)
BLUE SAPPHIRE INFORMATION
No.of Stones 15 Pieces
Total Weight 1.80 Carat (Approximate)
Dimension(approx) Round-2.50X2.50 mm-15 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 30 Pieces
Total Weight 0.39 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-30 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
blue-sapphire-rings