Natural Black Opal Infinity Earrings with Screw Back

Sale price $516.00 Regular price $579.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Enduring Design with Symbolic Elegance

These natural black opal infinity earrings are designed for those who appreciate meaning woven into fine jewelry. The infinity motif represents continuity and connection, while the black opal introduces depth, color play, and individuality.

Crafted for everyday refinement, this design balances visual interest with a composed silhouette suitable for both casual and elevated wear.

Infinity Setting with Secure Wear

The infinity-inspired structure frames the center stones without overwhelming them, creating a flowing form that feels intentional and timeless. Paired with a screw-back closure, the earrings are designed to stay comfortably in place throughout the day.

This combination makes the earrings well suited for long hours of wear, offering reassurance without compromising style.

Natural Black Opal Character

Natural black opal is known for its dark body tone and subtle flashes of color that shift with movement and light. Each stone brings its own character, making every pair visually distinctive while remaining understated.

The gemstone’s visual depth pairs naturally with minimalist metalwork, allowing the design to feel expressive without excess.

High-Level Features

  • Infinity-inspired earring design
  • Natural black opal center stones
  • Screw-back closure for secure wear
  • Balanced profile for daily comfort
Product Information
SKU SHP-EARRINGS032210934
Length 11.1 mm
Width 5.8 mm
Metal Weight 1.30 gm (Approximate)
Total Stone Weight 0.90 Carat (Approximate)
BLACK OPAL INFORMATION
No.of Stones 2 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Round-5X5 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-opal-earrings

FAQs: Black Opal Infinity Earrings

Are natural black opals suitable for everyday earrings?

Natural black opals are commonly used in fine jewelry and can be worn regularly with mindful care and proper storage.

What does the infinity design symbolize?

Infinity designs are often associated with continuity, connection, and lasting meaning, making them popular for everyday jewelry.

Do screw-back earrings feel comfortable for long wear?

Screw-back closures are designed to provide a secure fit and are commonly chosen for comfort during extended wear.

Will each black opal look the same?

Natural black opals can vary slightly in color play and pattern, which contributes to the individuality of each piece.

Are these earrings suitable for gifting?

The infinity motif and secure design make these earrings a thoughtful option for personal wear or gifting occasions.