Natural Black Onyx Star Pendant Necklace for Women

Sale price $531.00 Regular price $597.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Enchant your everyday look with this dazzling Star Pendant Necklace, a perfect blend of sparkle and sophistication. At its center lies a 4 mm Round Shape Black Onyx stone set in Prong Setting, carefully set in a striking Star Shaped motif that captures light beautifully from every angle. This Fine Pendant Necklace is designed to celebrate individuality and elegance, adding a subtle yet unforgettable shine to any outfit, whether you are heading to a casual brunch or a glamorous evening event. The sleek design makes it effortless to layer with other necklace or wear on its own as a statement piece that draws the eye. Expertly crafted with attention to detail, the Black Onyx Pendant Necklace comes with a stylish jewelry box, making it a ready-to-gift treasure for birthdays, anniversaries or any special moment. The rich AAA Quality Black Onyx symbolizes strength and confidence, while the star design adds a playful touch of charm and magic. Embrace this December Birthstone Necklace as a little piece of everyday luxury, a symbol of your style, grace, and sparkle. Perfect for women who love jewelry that is both timeless and modern, this Black Onyx Necklace for Women is destined to become a favorite in any collection.

Product Information
SKU SHP-PENDANT042170210
Length 18.7 mm
Width 12.6 mm
Metal Weight 3.60 gm (Approximate)
Total Stone Weight 0.22 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 1 Pieces
Total Weight 0.22 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
black-onyx-necklaces