Natural Black Onyx Diamond Leaf Stud Earrings with Screw Back

Regular price $1,025.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Bold Contrast with Nature-Inspired Detail

The Natural Black Onyx Diamond Leaf Stud Earrings are designed for those who appreciate subtle statement pieces. The deep tone of black onyx contrasts with the brilliance of diamonds, while the leaf-inspired design introduces an organic, refined element.

This balance makes the earrings suitable for both everyday wear and occasion styling.

Leaf Motif with Secure Setting

The leaf design adds texture and dimension, creating a structured yet delicate appearance. The arrangement of stones enhances the form without overwhelming the overall silhouette.

The screw back closure provides added security, making the earrings suitable for extended wear.

Black Onyx with Diamond Accents

Black onyx is valued for its rich, uniform color, offering a strong visual contrast when paired with diamonds. This combination creates a balanced look that remains both modern and timeless.

With proper care, the materials are suitable for regular use while maintaining their appearance.

High-Level Features Buyers Appreciate

The leaf-inspired design introduces a natural aesthetic, while the contrast between onyx and diamonds adds depth. The stud format ensures ease of wear and versatility across different styles.

These earrings can be worn alone or paired with other pieces, supporting a cohesive and refined look.

Product Information
SKU SHP-EARRINGS082310505
Weight 1.50 gm (Approximate)
Center Stone Weight 0.44 Carat (Approximate)
BLACK ONYX INFORMATION
No.of Stones 2 Pieces
Total Weight 0.44 Carat (Approximate)
Dimension(approx) Round-4X4 mm-2 Pcs
Color Black
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 26 Pieces
Total Weight 0.35 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-4 Pcs
Round-1.20X1.20 mm-10 Pcs
Round-1.30X1.30 mm-8 Pcs
Round-1.50X1.50 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
stud-earrings

FAQs About: Natural Black Onyx Diamond Leaf Stud Earrings with Screw Back

Are screw back earrings secure for daily wear?
Yes, screw back closures are designed to provide added security, making them suitable for everyday use.
What makes black onyx unique?
Black onyx is known for its deep, uniform color, offering a bold and clean appearance.
Is the leaf design suitable for everyday styling?
Yes, the leaf motif adds subtle detail while remaining refined enough for daily wear.
Can these earrings be worn for formal occasions?
Yes, their balanced design makes them suitable for both casual and formal settings.
Are onyx and diamonds a good combination?
Yes, the contrast between black onyx and diamonds creates a visually balanced and elegant look.
Who are these earrings ideal for?
They are ideal for individuals who prefer bold color contrasts combined with nature-inspired design elements.