Natural Aquamarine Flower Promise Ring with Certificate

Sale price $532.00 Regular price $597.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Promise in Bloom

The Natural Aquamarine Flower Promise Ring with Certificate captures the sentiment of a heartfelt commitment through a delicate floral design. Centered with natural aquamarine, this ring offers a soft, serene blue tone that feels fresh and elegant. It is designed for those marking a meaningful moment—whether a promise, milestone, or personal celebration—with a refined yet romantic piece.

Floral Design & Setting

The flower-inspired arrangement highlights the center aquamarine while creating gentle dimension across the top of the ring. The carefully structured setting supports the stone securely while maintaining a graceful silhouette. The petal motif adds character without overwhelming the finger, making it suitable for daily wear or occasional styling.

Natural Aquamarine Character

Aquamarine is appreciated for its clear, tranquil blue appearance and luminous quality. As a natural gemstone, subtle variations in tone may occur, adding individuality to each ring. With proper care and mindful wear, aquamarine can be enjoyed regularly. Removing the ring during strenuous activities helps preserve its finish and overall integrity.

What Buyers Often Consider

  • Natural aquamarine: soft blue hue with a calming presence.
  • Floral motif: symbolic design suited for promise or milestone gifting.
  • Certified piece: includes certification as listed on the product page.
  • Metal options available: select your preferred metal directly from the product options.
Product Information
SKU SHP-RINGS082223753
Metal Weight 2.87 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
AQUAMARINE INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Bead-Set
Quality Grade AAA
View More

Product Parent Collection Handle
aquamarine-rings
Is this aquamarine ring suitable for daily wear?
Aquamarine can be worn regularly with proper care. It is recommended to remove the ring during high-impact activities to help maintain its finish and structure.
Does this ring include a certificate?
Yes, this promise ring includes certification as specified on the product page.
What does the flower design symbolize?
A floral motif often represents growth, affection, and new beginnings, making it a meaningful choice for a promise ring.
Can I choose different metal options?
Available metal options can be selected directly from the product customization section on the page.
How should I clean this aquamarine ring?
Clean gently using mild soap, warm water, and a soft cloth. Avoid harsh chemicals and store separately to reduce surface scratches.