Natural Amethyst Star Of David Necklace with Chain

Regular price $663.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Embrace the magic of subtle sparkle with this Star Pendant Necklace, designed to shine as brightly as she does. At the center of the charming Star motif rests a 5 mm Round Shape Amethyst set in Prong Setting, glowing with a rich purple hue that feels both dreamy and elegant. The star design adds a playful yet meaningful touch, symbolizing hope, guidance and positivity. The pendant hangs beautifully from a fine chain that sits comfortably on the neckline, making it perfect for everyday wear. The secure Lobster Clasp Closure keeps it safely in place, so she can move through her day with ease and confidence. Whether styled with a casual outfit or a dress for a night out, this Amethyst Pendant Necklace adds just the right hint of color and sparkle. This February Birthstone Necklace arrives in a lovely jewelry box, ready to gift for birthdays, graduations, anniversaries or simply to remind someone how special they are. Full of charm, this Amethyst Necklace for Women is a little piece of the sky she can carry wherever she goes.

Product Information
SKU SHP-PENDANT042170747
Length 18.7 mm
Width 12.6 mm
Metal Weight 4.10 gm (Approximate)
Total Stone Weight 0.45 Carat (Approximate)
AMETHYST INFORMATION
No.of Stones 1 Pieces
Total Weight 0.45 Carat (Approximate)
Dimension(approx) Round-5X5 mm-1 Pcs
Color Violet
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
amethyst-necklaces