Moissanite Star Earring for Helix Piercing

Sale price $688.00 Regular price $790.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This helix earring features a star-shaped design accented with moissanite gemstones. The star motif creates a distinctive visual element while the gemstones introduce a subtle yet noticeable sparkle.

Designed for helix piercing placement, the earring combines decorative form with a compact structure suitable for cartilage jewelry styling.

Star Motif Jewelry Design

Star-shaped jewelry designs often symbolize guidance and individuality while adding a unique visual accent to earrings. The geometric form draws attention without overwhelming the surrounding jewelry pieces.

In this design, the star shape works as the central feature, creating a distinctive appearance that stands out in cartilage jewelry collections.

Helix Piercing Jewelry Style

Helix earrings are created specifically for cartilage piercings located along the upper outer ear. These designs are typically compact and balanced so they fit comfortably within the natural curve of the ear.

Jewelry for helix piercings is often chosen for its ability to add subtle detail and individuality to ear styling.

Moissanite Gemstone

Moissanite is known for its strong brilliance and light dispersion, creating noticeable sparkle in jewelry. Its optical properties allow it to reflect light effectively even in smaller gemstone settings.

Moissanite gemstones are created without traditional mining, though environmental impact can vary depending on production processes and energy sources.

Distinctive Cartilage Jewelry

Cartilage earrings often emphasize compact design combined with visual detail. The star shape paired with moissanite gemstones introduces a decorative element while maintaining the scale needed for helix jewelry.

This balance of form and sparkle results in an earring that complements curated ear styling while remaining visually distinctive.

Product Information
SKU SHP-BODYJ052310022
Length 6.3 mm
Width 6.3 mm
Height 2 mm
Metal Weight 0.60 gm (Approximate)
Total Stone Weight 0.26 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 12 Pieces
Total Weight 0.26 Carat (Approximate)
Dimension(approx) Round-3X3 mm-1 Pcs
Round-2X2 mm-1 Pcs
Round-1.20X1.20 mm-5 Pcs
Round-0.80X0.80 mm-5 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
helix-earrings

FAQs About: Moissanite Star Earring for Helix Piercing

What is a helix earring?
A helix earring is designed for cartilage piercings along the upper outer edge of the ear and is typically smaller to fit comfortably in that area.
What is moissanite?
Moissanite is a gemstone known for its strong brilliance and light dispersion, producing noticeable sparkle in jewelry designs.
Why are star-shaped earrings popular?
Star-shaped earrings offer a distinctive geometric style that stands out while remaining versatile for everyday jewelry styling.
Are helix earrings different from standard stud earrings?
Helix earrings are specifically designed for cartilage piercings and are often smaller or shaped differently than standard stud earrings used in earlobe piercings.
What makes moissanite sparkle?
Moissanite has optical properties that create strong light reflection and dispersion, which contribute to its bright sparkle.
Can helix earrings be worn as part of layered ear styling?
Helix earrings are commonly used in layered ear styling to add decorative detail to cartilage piercings alongside other earrings.