Moissanite Snowflake Heart Pendant Necklace

Regular price $647.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Moissanite Snowflake Heart Pendant Necklace

This pendant necklace features a snowflake-inspired heart design accented with moissanite gemstones that add brightness and visual detail. The heart motif brings a romantic element to the piece, while the snowflake pattern introduces delicate symmetry within the design.

The combination of these elements creates a pendant that blends decorative structure with gemstone sparkle, resulting in a refined jewelry piece suited for everyday wear or special occasions.

Snowflake Inspired Pendant Design

Snowflake-inspired jewelry designs are recognized for their balanced symmetry and intricate structure. The repeating pattern of the snowflake form creates a decorative appearance that adds visual depth to the pendant.

In this necklace, the snowflake structure is incorporated within the heart silhouette, allowing both shapes to work together as a cohesive design.

Heart Motif Jewelry Style

Heart-shaped jewelry is often associated with sentiment and personal expression. The shape has long been used in necklaces and pendants to symbolize connection and meaningful occasions.

When combined with detailed gemstone settings, the heart motif becomes a focal point that reflects both elegance and symbolism.

Moissanite Gemstone Characteristics

Moissanite is a gemstone known for its strong brilliance and ability to reflect light. Its sparkle makes it a popular choice for fine jewelry designs that emphasize brightness and clarity.

Moissanite used in jewelry is created in controlled laboratory environments without traditional mining, though environmental impact may vary depending on production methods and energy sources.

Elegant Pendant Necklace Style

Pendant necklaces highlight a central decorative element that rests along the chain as the primary visual feature. This design format allows the pendant to remain the focal point while maintaining a balanced and wearable jewelry style.

The combination of a snowflake-inspired pattern with a heart silhouette and moissanite accents creates a necklace design that blends decorative detail with a classic pendant structure.

Product Information
SKU SHP-PENDANT072210153
Length 21 mm
Width 17 mm
Metal Weight 3.70 gm (Approximate)
Total Stone Weight 0.28 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 51 Pieces
Total Weight 0.28 Carat (Approximate)
Dimension(approx) Round-1.70X1.70 mm-1 Pcs
Round-1.30X1.30 mm-6 Pcs
Round-1.10X1.10 mm-1 Pcs
Round-1X1 mm-43 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
heart-necklaces

FAQs About: Moissanite Snowflake Heart Pendant Necklace

What is moissanite?
Moissanite is a gemstone valued for its brilliance and clarity. It is commonly used in jewelry because of its ability to reflect light effectively.
What does a heart pendant symbolize?
Heart pendants are often associated with affection and personal connection, making them a popular choice for meaningful jewelry gifts.
What is a snowflake jewelry design?
Snowflake jewelry designs feature symmetrical patterns inspired by natural snowflake structures, often used to create intricate and decorative jewelry styles.
Is moissanite suitable for everyday jewelry?
Moissanite is commonly used in everyday jewelry due to its durability and noticeable brilliance.
What is a pendant necklace?
A pendant necklace features a decorative element suspended from a chain, allowing the pendant to serve as the focal point of the jewelry piece.
Can pendant necklaces be layered with other jewelry?
Pendant necklaces can often be layered with other chains to create a personalized jewelry style depending on chain length and pendant size.