Moissanite Mothers Day Necklace with Baby Feet

Regular price $679.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Meaningful Design for a Special Bond

The Moissanite Mother's Day Necklace with Baby Feet is created to celebrate moments that hold personal significance. The baby feet motif symbolizes connection and memory, making it a thoughtful choice for meaningful gifting.

This piece is suited for those who value sentiment alongside refined design.

Symbolic Motif with Balanced Structure

The design centers around the baby feet element, offering a clear focal point while maintaining a balanced overall form. The structure ensures the pendant sits comfortably and aligns naturally when worn.

Its composition allows for both visual clarity and everyday usability.

Moissanite Stone Value

Moissanite is valued for its brilliance and clarity, adding a subtle reflective quality to the design. It is created without traditional mining, though impact varies by production and energy source.

With proper care, moissanite jewelry is suitable for regular wear, making it practical for everyday use.

High-Level Features Buyers Appreciate

The symbolic design offers emotional value, while the structured pendant ensures ease of wear. Its versatile appearance allows it to be worn alone or layered with other pieces.

This necklace works well as a personal keepsake or a meaningful gift for special occasions.

Product Information
SKU SHP-PENDANT052183339
Length 23 mm
Width 19 mm
Height 2.5 mm
Weight 6.80 gm (Approximate)
Center Stone Weight 0.73 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 43 Pieces
Total Weight 0.73 Carat (Approximate)
Dimension(approx) Round-1.20X1.20 mm-42 Pcs
Round-3X3 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-necklaces

FAQs About: Moissanite Mother's Day Necklace with Baby Feet

What does the baby feet design represent?
The baby feet motif symbolizes connection, memory, and meaningful moments, often associated with family and motherhood.
Is this necklace suitable for everyday wear?
Yes, with proper care, the necklace can be worn regularly due to its balanced and practical design.
Is moissanite a good choice for jewelry?
Moissanite is valued for its brilliance and durability, making it suitable for everyday jewelry.
Can this necklace be layered with other pieces?
Yes, its simple and meaningful design allows it to be layered with other necklaces if desired.
Is this necklace suitable as a gift?
Yes, it is designed to be a thoughtful gift, especially for occasions that celebrate family and personal milestones.
Who is this necklace ideal for?
It is ideal for individuals looking for a meaningful and symbolic jewelry piece with everyday versatility.