Modern Heart Necklace and Earrings Set with Certified Moissanite

Regular price $773.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Elevate your jewelry collection with this beautifully designed Heart Necklace and Earrings Set, a perfect blend of contemporary style and timeless charm. Crafted to make a subtle yet meaningful statement, the set features an elegant open heart motif that symbolizes love, connection, and grace. Half of each heart is delicately adorned with shimmering moissanite stones in pave setting. Complementing the necklace, the matching stud earrings mirror the same heart-shaped design, offering a cohesive and stylish finish to your ensemble. Designed with both beauty and comfort in mind, the earrings are secured with reliable screw-back closures, ensuring they stay in place while remaining easy to wear throughout the day. Whether you are dressing up for a special occasion or adding a touch of elegance to your everyday outfit, this Moissanite Jewelry Set transitions effortlessly to suit any moment. Perfect as a heartfelt gift, this Open Heart Pendant and Earrings carries a message of love and appreciation. Whether gifted to a partner, mother, daughter, or close friend, this Contemporary Necklace Set is a lasting reminder of thoughtfulness, style, and the beauty of connection.

Product Information
SKU SHP-PENDANT032214019
Metal Weight 7.00 gm (Approximate)
Total Stone Weight 0.71 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 151 Pieces
Total Weight 0.71 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-63 Pcs
Round-0.90X0.90 mm-42 Pcs
Round-1.10X1.10 mm-35 Pcs
Round-1X1 mm-11 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
heart-necklaces