Minimal Cubic Zirconia Chain Link Ring

Regular price $575.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Contemporary Ring with Subtle Edge

This minimal cubic zirconia chain link ring is designed for those who appreciate modern styling with a refined finish. The chain-inspired structure introduces a distinctive look while maintaining a clean and wearable aesthetic.

It offers a balance between statement and simplicity, making it suitable for everyday wear.

Chain Link Design with Functional Appeal

The chain link motif brings a contemporary edge to the design, creating visual interest through its structured pattern. Each link is crafted to maintain continuity, resulting in a cohesive and well-balanced form.

This design approach ensures both durability and a unique visual identity.

Cubic Zirconia Brilliance

Cubic zirconia is known for its clarity and reflective qualities, offering a bright and polished appearance. It provides a refined look that enhances the overall design without overwhelming it.

This makes it a suitable choice for those seeking subtle sparkle in a modern ring.

Versatile and Comfortable for Daily Wear

Designed with wearability in mind, this ring offers a comfortable fit for extended use. Its structure allows for ease of movement while maintaining a secure feel on the finger.

It can be worn alone or stacked with other rings to create a layered look.

Product Information
SKU SHP-RINGS0821329892
Width 4.9 mm
Height 2.1 mm
Weight 1.68 gm (Approximate)
ZIRCON INFORMATION
No.of Stones 68 Pieces
Total Weight 0.14 Carat (Approximate)
Dimension(approx) Round-0.80X0.80 mm-68 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Surface-Prong-Setting
Quality Grade AAAA
View More

Product Parent Collection Handle
eternity-rings

FAQs About: Minimal Cubic Zirconia Chain Link Ring