Marquise Diamond Leaf Cluster Earring for Helix Piercing

Sale price $691.00 Regular price $794.00
✓ Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 10K Yellow Gold
Post Length
Select Ear
Star Icon

Item Sold Singly

Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Radiant and intricate, the Diamond Cluster Earring is adorned with shimmering Marquise Shape Diamonds set in Prong Settings, arranged in a leaf motif. This diamond helix earring is a stunning piece of jewelry that can effortlessly transform any plain outfit into something vibrant and appealing with its charm. The Leaf Diamond Earring comes with a flat back closure, ensuring a snug fit for your helix, cartilage, or upper lobe piercings. Perfect for daily wear! All the diamonds in this earpiece are certified and undergo a thorough quality inspection. Whether you are heading out with friends or enjoying a brunch date, this Diamond Ear Crawler will surely make everyone admire your piercing jewelry. It radiates timeless elegance, adding a hint of sparkle to your look. An excellent gift choice, this cartilage earring is perfect for birthdays, anniversaries, graduations, or as a thoughtful bridesmaid present. Its overall design is simple yet sophisticated, truly a feast for the eyes.

Product Information
SKU SHP-BODYJ052310076
Metal Weight 0.33 gm (Approximate)
Total Stone Weight 0.25 Carat (Approximate)
DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.25 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-5 Pcs
Color HI
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade SI
View More