Marquise Cut Moissanite Bridal Dangle Earrings

Regular price $641.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Nature meets elegance in these beautifully designed Leaf Dangle Earrings, perfect for adding a delicate and stylish touch to any outfit. Each earring features marquise cut moissanite stones, carefully set in prongs. The design captures the graceful curves of a leaf, giving the Moissanite Bridal Earrings a refined yet lively appearance that draws attention in a subtle and sophisticated way. Lightweight and comfortable, the Moissanite Leaf Earrings are ideal for daily wear or special occasions. Screw back closures ensure they stay securely in place, letting you move with confidence while enjoying their sparkling charm. The elegant design is versatile enough to pair with both casual looks and dressy ensembles, making them a reliable go-to accessory for any wardrobe. Handcrafted with precision, these Nature Inspired Earrings combine artistry with durability, ensuring long-lasting shine and quality. The leaf motif adds a natural appeal that resonates with anyone who appreciates jewelry inspired by the beauty of nature. Packaged in a stylish jewelry box, they also make a thoughtful gift for birthdays, anniversaries, or any occasion worth celebrating.

Product Information
SKU SHP-EARRINGS082210102
Length 14.8 mm
Width 4.5 mm
Metal Weight 1.67 gm (Approximate)
Total Stone Weight 0.82 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 14 Pieces
Total Weight 0.82 Carat (Approximate)
Dimension(approx) Marquise-1.50X3.00 mm-6 Pcs
Marquise-2X4 mm-8 Pcs
Color White
Cut Brilliant
Shape Marquise
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-earrings