Marquise and Oval Shape Moissanite Half Eternity Ring

Regular price $605.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This half eternity ring features a sequence of marquise and oval shape moissanite stones arranged along the band. The alternating gemstone shapes create visual rhythm while allowing each stone to reflect light from different angles.

Moissanite gemstones are valued for their bright sparkle and reflective qualities, giving the ring a luminous appearance that enhances its elegant design.

Alternating Gemstone Design

The combination of marquise and oval stones introduces a distinctive pattern that sets this ring apart from traditional single-shape eternity styles. Each shape contributes its own character, creating a dynamic yet balanced arrangement across the band.

The elongated marquise stones add graceful structure, while the oval stones introduce soft curves that enhance the overall flow of the design.

Half Eternity Band Style

A half eternity ring features gemstones placed along the upper portion of the band while the underside remains smooth. This design allows the stones to remain visible when worn while maintaining a balanced structure for everyday comfort.

The arrangement also highlights the gemstones across the visible portion of the ring, ensuring the design maintains its brilliance and visual focus.

Moissanite Gemstone Brilliance

Moissanite is appreciated for its strong brilliance and ability to reflect light effectively. The gemstone is created without traditional mining, though environmental impact varies by production and energy source.

In this ring, the moissanite stones work together to produce a continuous line of sparkle that enhances the elegance of the alternating gemstone pattern.

Product Information
SKU SHP-RINGS042210053
Width 3 mm
Height 2 mm
Metal Weight 2.20 gm (Approximate)
Total Stone Weight 0.71 Carat (Approximate)
MOISSANITE INFORMATION
No.of Stones 9 Pieces
Total Weight 0.71 Carat (Approximate)
Dimension(approx) Marquise-2X4 mm-4 Pcs
Oval-2X3 mm-5 Pcs
Color White
Cut Brilliant
Shape Marquise, Oval
Setting Type Prong-Setting
Quality Grade D-VS1
View More

Product Parent Collection Handle
moissanite-women-wedding-bands

FAQs About: Marquise and Oval Shape Moissanite Half Eternity Ring

What is a half eternity ring?
A half eternity ring features gemstones set along the upper portion of the band while the lower portion remains smooth and without stones.
What is moissanite used for in jewelry?
Moissanite is commonly used in jewelry because of its strong brilliance and reflective sparkle, making it a popular gemstone for rings.
What is a marquise cut gemstone?
A marquise cut gemstone has an elongated shape with pointed ends, creating a distinctive and elegant appearance.
What is an oval cut gemstone?
An oval cut gemstone features an elongated rounded shape that enhances light reflection while maintaining a smooth outline.
Why are alternating gemstone shapes used in rings?
Alternating gemstone shapes create visual variety and rhythm within a ring design, making the overall pattern more distinctive and balanced.