Lab Ruby and Diamond Flower Engagement Ring in Split Shank

Regular price $1,107.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Floral Design with a Distinctive Presence

This lab ruby and diamond engagement ring is designed for those who seek a piece that feels expressive and symbolic rather than traditional. The flower-inspired composition introduces a sense of individuality, making it a meaningful choice for a personal milestone.

Its design offers a refined balance between decorative detail and overall structure, creating a ring that stands out without appearing overly ornate.

Split Shank for Visual Balance and Structure

The split shank design is not only a stylistic element but also a structural choice that distributes visual weight evenly across the ring. It creates an open, airy profile that enhances the central floral arrangement.

This design allows the ring to maintain a light appearance while supporting the overall composition, making it distinct from more conventional band styles.

A Floral Composition with Depth

The combination of ruby and diamond elements forms a layered design that adds dimension and visual interest. Each stone contributes to the overall floral motif, creating a cohesive and balanced look.

This arrangement ensures the ring captures attention through design rather than size alone, offering a more artistic expression.

Lab-Created Stones with a Contemporary Approach

The stones in this ring are created without traditional mining, offering an alternative perspective on sourcing. They provide the expected visual qualities while aligning with evolving preferences in jewelry.

Environmental impact varies by production and energy source, making it a consideration based on individual values.

Designed for Meaningful, Long-Term Wear

The structure of the ring is intended to support both comfort and durability, allowing it to be worn regularly while maintaining its detailed appearance. Its nature-inspired concept ensures it remains distinctive over time.

For those looking for an engagement ring that reflects personality and thoughtful design, this piece offers a refined and enduring option.

Product Information
SKU SHP-RINGS0821221722
Width 3.8 mm
Height 7 mm
Weight 2.52 gm (Approximate)
Center Stone Weight 0.34 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.34 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 16 Pieces
Total Weight 0.32 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-12 Pcs
Marquise-1.50X3.00 mm-4 Pcs
Color HI
Cut Brilliant
Shape Round, Marquise
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
july-birthstone-jewelry

Faq About: Lab Ruby and Diamond Flower Engagement Ring in Split Shank

What makes a split shank engagement ring unique?
A split shank design features a band that divides as it approaches the center, creating an open structure that enhances the overall appearance of the ring.
Is a floral engagement ring suitable for everyday wear?
Yes, floral engagement rings can be worn daily when designed with balanced structure and cared for properly.
Are lab-created ruby and diamonds durable?
Lab-created stones are designed to offer durability suitable for regular wear, similar to their natural counterparts.
Can this ring be paired with a wedding band?
Yes, it can be paired with a wedding band, though the split shank and floral design may influence the choice of band style for a proper fit.
Does the design require special maintenance?
Rings with detailed designs benefit from regular cleaning to maintain their appearance, especially around intricate areas.
Is this ring suitable for someone who prefers non-traditional styles?
Yes, the floral motif and split shank design make it a strong choice for those looking for an engagement ring outside of classic solitaire styles.