Lab Grown Ruby Solitaire Infinity Pendant Necklace with Diamond

Regular price $648.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Created for love that feels lasting and deeply personal, this lab grown ruby solitaire infinity pendant necklace brings rich red color and delicate diamond sparkle into one meaningful design. The infinity silhouette cradles a round lab grown ruby at the center, giving the necklace a romantic focal point with a graceful sense of movement. Thoughtful as a gift for a girlfriend, wife, anniversary, birthday, or heartfelt milestone, it carries the feeling of enduring affection in a refined everyday keepsake.

Lab Grown Ruby Solitaire Infinity Pendant Necklace with Diamond Accents

This pendant necklace is crafted with an 8 MM round lab grown ruby weighing approximately 2.35 carats, secured in a prong setting and graded AAAA quality. Ten round lab grown diamonds add a subtle white sparkle, totaling approximately 0.06 carat with EF-VS quality. The necklace is available with an 18 inch chain or without a chain, and can be selected in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, or 18K yellow gold.

What Makes This Special

The 8X8 MM round lab grown ruby gives the pendant its vivid red center and expressive presence. Its brilliant cut helps the gemstone reflect light from within the infinity-inspired frame, making the ruby the emotional focus of the necklace.

Ten round lab grown diamonds, each measuring approximately 1.10X1.10 MM, bring a refined accent to the design. Their white color and EF-VS quality add brightness without overpowering the ruby.

With an approximate finished weight of 2.64 grams, the pendant has a wearable feel while still offering a noticeable center stone. The prong settings keep both the ruby and diamond accents secure while allowing the stones to remain visually open.

Why Choose This Design

The infinity motif gives this necklace emotional depth, making it more than a simple solitaire pendant. It symbolizes ongoing love, connection, and devotion, while the ruby adds a passionate red center that feels personal and expressive.

The combination of a larger round ruby and delicate diamond accents creates balance: color remains the focus, and the diamonds add a fine trace of brilliance. The option to choose the pendant with an 18 inch chain or without a chain also makes it easy to style according to personal preference.

Design Meaning

The infinity shape represents a bond without end, making this pendant especially meaningful for romantic gifting and lasting commitments. Ruby is often associated with love, passion, and devotion, while the diamond accents bring a sense of brightness and celebration. Together, the design speaks to affection that continues through every chapter.

Authenticity & Craftsmanship

Rosec Jewels crafts this lab grown ruby and diamond pendant necklace with careful attention to stone placement, prong security, and refined finishing. Each piece goes through stone inspection, setting security review, and finishing inspection before dispatch, helping ensure the necklace arrives ready for gifting or personal wear. A Certificate of Authenticity is offered with the product for added confidence. To care for the pendant, clean it gently with a soft cloth, avoid harsh chemicals, and store it separately to help protect the ruby, diamonds, chain, and metal finish.

Style and Wearability

This necklace brings a rich point of red color to the neckline, framed by the soft curve of the infinity design and the sparkle of diamond accents. It can be worn as a meaningful everyday pendant or styled for dinner dates, anniversaries, celebrations, and special occasions. The available metal choices across sterling silver and yellow or white gold make it easy to choose a finish that suits the wearer’s jewelry wardrobe.

Product Information
SKU SHP-PENDANT112310073
Weight 2.64 gm (Approximate)
Center Stone Weight 2.35 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 2.35 Carat (Approximate)
Dimension(approx) Round-8X8 mm-1 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 10 Pieces
Total Weight 0.06 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-10 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade EF-VS
View More

FAQs About: Lab Grown Ruby Solitaire Infinity Pendant Necklace with Diamond

What makes this lab grown ruby infinity necklace a meaningful gift?

The infinity design symbolizes lasting love and ongoing connection, while the red lab grown ruby adds a romantic focal point. This makes the necklace suitable for anniversaries, birthdays, romantic milestones, and heartfelt gifting.

What is the center stone in this pendant necklace?

The center stone is a round lab grown ruby measuring approximately 8X8 MM. It has a brilliant cut, red color, AAAA quality grade, and an approximate weight of 2.35 carats.

Does this ruby pendant include diamonds?

Yes. The pendant includes 10 round lab grown diamonds measuring approximately 1.10X1.10 MM each. The diamonds total approximately 0.06 carat and have EF-VS quality.

What setting style is used for the ruby and diamonds?

The lab grown ruby and lab grown diamonds are secured in prong settings. This setting style helps keep the stones secure while allowing their color and sparkle to remain clearly visible.

Which metal options are available for this necklace?

This necklace is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold.

Can I choose this pendant with or without a chain?

Yes. The necklace is available with an 18 inch chain or without a chain, allowing you to select the option that best fits your styling preference.

How should I care for this ruby and diamond pendant necklace?

Clean the pendant gently with a soft cloth and keep it away from harsh chemicals, perfumes, and abrasive surfaces. Store it separately when not in use to help protect the lab grown ruby, lab grown diamonds, prong settings, chain, and metal finish.