Lab Grown Ruby Diamond Rose Flower Earrings

Sale price $657.00 Regular price $755.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Ruby Rose Flower Earrings with Elegant Detail

The Lab Grown Ruby Diamond Rose Flower Earrings showcase a floral design that blends gemstone brilliance with artistic craftsmanship. Inspired by the delicate shape of a blooming rose, the arrangement of rubies and diamonds creates a striking yet refined visual effect. The vibrant red hue of ruby forms the focal point, while the diamonds add subtle brightness that enhances the overall design.

Floral Design with Dimensional Beauty

The rose flower motif brings natural elegance to the earrings, giving them a sculpted appearance that reflects light from different angles. Each gemstone is placed to highlight the layered floral structure, allowing the design to feel both intricate and balanced. This thoughtful composition adds depth while maintaining a graceful and wearable silhouette.

Lab Grown Ruby Characteristics

Lab grown rubies offer the rich red color traditionally associated with ruby while being created without traditional mining. The environmental impact may vary depending on production methods and energy sources, but these gemstones are valued for their vibrant color and consistent appearance.

A Versatile Floral Jewelry Piece

These earrings combine expressive design with timeless gemstone pairing. The rose-inspired motif makes them suitable for meaningful gifting, special occasions, or everyday elegance. The balanced design allows the earrings to complement both classic and modern jewelry styles.

Product Information
SKU SHP-EARRINGS112310097
Metal Weight 4.80 gm (Approximate)
Total Stone Weight 2.95 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 2 Pieces
Total Weight 2.74 Carat (Approximate)
Dimension(approx) Round-6X6 mm-2 Pcs
Color Red
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAAA
LAB GROWN DIAMOND INFORMATION
No.of Stones 14 Pieces
Total Weight 0.21 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-14 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More
What makes ruby a popular gemstone for earrings?
Ruby is admired for its rich red color and long-standing association with elegance and passion. Its vibrant tone makes it a striking choice for gemstone earrings.
Are lab grown rubies real gemstones?
Yes. Lab grown rubies share the same chemical and optical properties as natural rubies but are created in controlled environments rather than mined from the earth.
What is the inspiration behind rose flower jewelry?
Rose flower jewelry designs are inspired by the natural shape of a blooming rose. They are often chosen to represent love, beauty, and timeless elegance.
Can floral earrings be worn for everyday styling?
Floral earrings are versatile and can complement both everyday outfits and special occasions. Their decorative design allows them to add subtle elegance to different styles.
How should ruby earrings be cleaned?
Ruby earrings can be cleaned with mild soap, warm water, and a soft brush. Rinse carefully and dry with a soft cloth before storing them safely.