Lab Grown Diamond Leo Zodiac Necklace

Regular price $721.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Radiating strength, confidence, and charisma - just like the Leo soul, this dazzling Diamond Leo Necklace is crafted to celebrate the bold and magnetic energy of those born between July 23 and August 22. This Zodiac Pendant Necklace is beautifully outlined with lab grown diamonds set in pave setting and captures the essence of a true fire sign. Whether you are a Leo who loves the spotlight or someone who carries quiet confidence with pride, this Star Sign necklace is a perfect reflection of your unique identity. Designed to make a statement while remaining timeless, the zodiac motif shines with hand selected, ethically sourced diamonds that shimmer with every movement. This Zodiac Leo Necklace is available in a variety of metal types and color options, allowing you to customize it to match your personal style. Whether you are treating yourself or gifting it to a special person in your life, this necklace blends astrology with luxury, making it a piece you will treasure forever.

Product Information
SKU SHP-PENDANT0921397841
Length 19.5 mm
Width 21.5 mm
Metal Weight 3.04 gm (Approximate)
Total Stone Weight 0.51 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 50 Pieces
Total Weight 0.51 Carat (Approximate)
Dimension(approx) Round-1.30X1.30 mm-49 Pcs
Round-1.60X1.60 mm-1 Pcs
Color White
Cut Brilliant
Shape Round
Setting Type Pave-Setting
Quality Grade EF-VS
View More

Product Parent Collection Handle
leo-zodiac-sign-jewelry