Lab Created Ruby Heart Promise Ring with Diamond Halo

Regular price $1,372.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Description

Made for promises spoken from the heart, this lab created ruby heart promise ring brings together vivid red color, romantic shape, and diamond sparkle. A 6 mm heart shaped ruby forms the emotional center of the design, framed by a delicate halo of round diamonds and finished with diamond side stones along the band. It is a meaningful choice for a promise, anniversary, milestone, July birthstone gift, or a love-filled moment that deserves a lasting keepsake.

Lab Created Ruby Heart Promise Ring with Diamond Halo

This ruby and diamond promise ring is crafted with one heart shaped lab created ruby measuring approximately 6 x 6 mm and 28 round diamond accents. The ruby is brilliant cut, red in color, AAAA quality grade, and secured in a prong setting, while the HI-SI diamonds create a sparkling halo and side stone detail. With an approximate center stone weight of 0.90 carat, an approximate diamond weight of 0.55 carat, and multiple sterling silver and gold options, the ring offers a romantic colored gemstone design with a polished bridal-inspired finish.

What Makes This Special

The ring features one heart shaped lab created ruby with an approximate weight of 0.90 carat. The center stone measures approximately 6 x 6 mm, giving the ring a clearly romantic focal point with rich red color.

The diamond accents include 28 round diamonds with an approximate total weight of 0.55 carat. The layout includes 12 round diamonds measuring approximately 1.40 x 1.40 mm and 16 round diamonds measuring approximately 1.50 x 1.50 mm, adding sparkle around the ruby and along the band.

The ruby and diamonds are brilliant cut and secured in prong settings. The lab created ruby is AAAA quality grade, while the diamonds are HI in color and SI in quality grade. The ring has an approximate weight of 3.50 gm. Metal options include 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold. Ring sizes are available from US 3 to US 13, including quarter-size options.

Why Choose This Design

A heart shaped ruby makes the sentiment of the ring immediately clear, giving the design a direct connection to love, devotion, and emotional commitment. The red gemstone adds warmth and passion, while the diamond halo brightens the center stone and creates a more celebratory look.

The prong setting keeps the heart ruby and round diamonds visible, allowing the ring to catch light from different angles. Diamond side stones extend the sparkle across the band, making the design feel complete enough for a promise ring, engagement-inspired gift, or anniversary piece.

Design Meaning

The heart motif is a classic symbol of love, loyalty, and deep affection. Paired with ruby, a gemstone often associated with passion, courage, and devotion, the design becomes especially meaningful for a promise or romantic milestone. The surrounding diamond halo can represent light and support around the bond being celebrated, while the side stones add a sense of continuing sparkle along the journey ahead.

Authenticity & Craftsmanship

Each ring is carefully crafted with attention to heart ruby placement, diamond halo alignment, prong setting security, balanced band detail, and refined finishing. Rosec Jewels offers a Certificate of Authenticity with the product, adding confidence to the purchase experience. Before dispatch, every piece goes through stone inspection, setting security review, and finishing inspection to help ensure it is ready for wearing or gifting. For lasting care, store the ring separately, avoid harsh chemicals, and wipe it gently with a soft cloth after wear.

Style and Wearability

This ruby heart promise ring brings romantic color and diamond brilliance to the hand without losing its personal softness. It pairs beautifully with slim diamond bands, plain gold rings, ruby earrings, delicate pendants, and everyday bracelets. Whether worn as a promise ring, anniversary ring, July birthstone piece, or heartfelt self-gift, it adds a warm red focal point with meaningful sparkle.

Product Information
SKU SHP-RINGS082211666
Weight 3.50 gm (Approximate)
Center Stone Weight 0.90 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 1 Pieces
Total Weight 0.90 Carat (Approximate)
Dimension(approx) Heart-6X6 mm-1 Pcs
Color Red
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.55 Carat (Approximate)
Dimension(approx) Round-1.40X1.40 mm-12 Pcs
Round-1.50X1.50 mm-16 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
heart-engagement-rings

FAQs About: Lab Created Ruby Heart Promise Ring with Diamond Halo

What makes this ruby heart promise ring meaningful?

The heart shaped ruby directly symbolizes love, affection, and devotion, while the diamond halo adds light around the center stone. This makes the ring a thoughtful choice for promises, anniversaries, romantic milestones, July birthdays, or heartfelt gifting.

What is the center stone in this ring?

The center stone is one heart shaped lab created ruby measuring approximately 6 x 6 mm. It has an approximate weight of 0.90 carat, red color, brilliant cut faceting, and an AAAA quality grade.

Does this ring include diamond accents?

Yes. The ring includes 28 round diamonds with an approximate total weight of 0.55 carat. The layout includes 12 round diamonds measuring approximately 1.40 x 1.40 mm and 16 round diamonds measuring approximately 1.50 x 1.50 mm.

What setting style is used for the ruby and diamonds?

The heart shaped ruby and the round diamond accents are secured in prong settings. This setting style keeps the stones visible and helps define the ruby center, diamond halo, and side stone detail.

What metal options are available for this promise ring?

This design is available in 92.5 sterling silver, 10K white gold, 10K yellow gold, 14K white gold, 14K yellow gold, 18K white gold, and 18K yellow gold, giving buyers several choices in metal tone and purity.

Does this ring come with authenticity support?

Yes. Rosec Jewels offers a Certificate of Authenticity with the product. The ring also goes through stone inspection, setting security review, and finishing inspection before dispatch.

How should I care for this lab created ruby and diamond ring?

Store the ring separately to help prevent scratches, avoid harsh chemicals, and wipe it gently with a soft cloth after wear. For deeper cleaning, use mild soap, lukewarm water, and a soft brush, then dry the ring carefully before storing.