Lab Created Ruby and Diamond Butterfly Heart Necklace

0
Regular price $1,277.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

This Butterfly and Heart Necklace is a beautiful way to show love and new beginnings. The design features an elegant open heart pendant that feels modern yet timeless. One side of the heart is polished metal, while the other half is decorated with sparkling round cut diamonds, adding the perfect touch of shimmer and detail. Inside the heart sits a delicate butterfly motif made from marquise cut lab created rubies. Each ruby is secured in 2-prong setting, carefully placed to form the graceful wings of the butterfly. The marquise shape gives the butterfly a natural and flowing look, making the design feel lively and symbolic. Butterflies often represent transformation, hope, and growth, while the heart stands for love - together, they create a powerful and thoughtful meaning. The Ruby and Diamond Pendant is attached to a sleek bail that allows it to hang beautifully on the neckline. You also have the option to purchase it with or without a chain, so you can style it your way or pair it with a chain you already own. Perfect for birthdays, anniversaries, Valentine’s Day, or just as a sweet surprise, this Ruby Heart Necklace makes a meaningful gift for someone special. Whether it is for your partner, daughter, sister, or best friend, this charming piece is designed to be treasured and worn with love every day.

Product Information
SKU SHP-PENDANT012148039
Length 26 mm
Width 18.5 mm
Metal Weight 4.30 gm (Approximate)
Total Stone Weight 1.22 Carat (Approximate)
LAB CREATED RUBY INFORMATION
No.of Stones 4 Pieces
Total Weight 0.74 Carat (Approximate)
Dimension(approx) Marquise-2.50X5.00 mm-2 Pcs
Marquise-2X4 mm-2 Pcs
Color Red
Cut Brilliant
Shape Marquise
Setting Type 2-Prong-setting
Quality Grade AAAA
DIAMOND INFORMATION
No.of Stones 19 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-19 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type 2-Prong-setting
Quality Grade SI
View More

Product Parent Collection Handle
heart-necklaces