Illusion Real Diamond Celtic Knot Band Ring for Women

Regular price $1,245.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Timeless Symbol in Gold

The 0.50 CT Real Diamond Celtic Knot Band Ring in Gold is designed for those who value symbolism as much as craftsmanship. The intricate Celtic knot pattern represents eternity and interconnectedness, making it a meaningful choice for weddings, anniversaries, or personal milestones. Balanced in form and proportion, this band offers presence without excess, allowing it to transition seamlessly from daily wear to special occasions.

Celtic Knot Detailing with Diamond Brilliance

The continuous knot motif creates a flowing, interwoven pattern around the band, symbolizing unity without beginning or end. Diamonds are integrated within the design to enhance light reflection while maintaining the integrity of the symbolic structure. The setting is crafted to keep the stones secure while preserving a smooth profile that rests comfortably against the finger.

Natural Diamond Characteristics

Natural diamonds are valued for their durability and brilliance, making them well-suited for rings intended for frequent wear. Their strength supports everyday use when handled with standard jewelry care. The combination of real diamonds and gold provides a classic foundation for long-term wear.

High-Level Features

  • Celtic knot band symbolizing eternity and connection.
  • 0.50 carat total weight of real diamonds.
  • Designed for standalone wear or pairing with engagement rings.
  • Metal options and complete specifications are detailed in the product tables above.
Product Information
SKU SHP-RINGS032014042
Width 7.4 mm
Height 5.3 mm
Weight 3.68 gm (Approximate)
DIAMOND INFORMATION
No.of Stones 9 Pieces
Total Weight 0.48 Carat (Approximate)
Dimension(approx) Round-1.50X1.50 mm-2 Pcs
Round-2.20X2.20 mm-7 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Illusion-Setting
Quality Grade SI
View More

Product Parent Collection Handle
diamond-engagement-rings

FAQs About: Real Diamond Celtic Knot Band Ring in Gold

Is this ring suitable as a wedding band?
Yes, the continuous Celtic knot design and diamond detailing make it a meaningful option for a wedding band or anniversary ring.
Can this band be worn every day?
Natural diamonds are durable and suitable for daily wear. Regular cleaning and mindful handling will help maintain the ring’s appearance over time.
Is this sold as a single ring?
This listing is for a single band ring unless otherwise specified in the product detail section.
Can it be paired with an engagement ring?
The band’s profile allows it to complement many engagement ring styles. Pairing suitability depends on the height and shape of the accompanying ring.
Where can I review the full specifications?
Detailed information about metal options, diamond weight, and other specifications is available in the product detail tables above.