IGI Certified Round Lab Grown Diamond Wedding Necklace for Women

Sale price $1,224.00 Regular price $1,406.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Let your style sparkle as bright as this Lab Created Diamond Necklace by Rosec Jewels. This stunning Halo Necklace is a timeless piece that showcases a dazzling 8 MM round lab grown diamond at its center, encircled by shimmering white gemstones set in a prong setting. Hanging gracefully from a cable chain, this 2 Carat Diamond Necklace offers both comfort and security, making it ideal for all-day wear. Not only does this Round Necklace radiate luxury, but it also represents a thoughtful choice, crafted with E-VS1 quality IGI Certified lab made diamonds. This eco-friendly option is also budget-friendly. It beautifully combines classic elegance with modern sustainability, providing you with the same sparkle as a mined diamond, but without the high cost or environmental concerns. Furthermore, this Classic Necklace comes in various metal color options, allowing you to select the one that best matches your personal style and create a truly unique piece. If you are in search of something distinctive, timeless, and radiant, this Certified Diamond Necklace for Women is the perfect way to celebrate your love. Gift it to your girlfriend or wife, and let this Halo Necklace convey the depth of your lasting affection. Prepare to shine like never before.

Design Inspiration

Rooted in the symbolism of continuity, this necklace is composed of round lab-grown diamonds arranged in a seamless sequence that echoes unity and enduring connection. The circular silhouettes create a rhythmic flow, while the refined structure enhances the natural brilliance of each stone without visual interruption. Designed with a romantic yet polished sensibility, the piece reflects a harmonious balance between form and light, offering a sophisticated interpretation of fine diamond necklace artistry.

Product Information
SKU SHP-PENDANT022610007
Weight 2.85 gm (Approximate)
Center Stone Weight 2.04 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 24 Pieces
Total Weight 2.18 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-23 Pcs
Round-8X8 mm-1 Pcs
Color E
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS1
View More

Product Parent Collection Handle
igi-certified-diamonds