Heart Shape Lab Grown Black and White Diamond Cat Stud Earrings

Regular price $721.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Surprise and shower your lovely lady with love by presenting this exquisite Lab Created Black Diamond Stud Earring. Let your partner feel the depth of your affection and care through this thoughtful gift. Crafted with a whimsical cat motif, each earring features a striking heart shaped lab grown black diamond set at the center, in prong setting. Delicate white diamonds are carefully studded along the cat’s tail and nose to introduce a sparkle that enhances the overall character of the piece. These thoughtful details bring the design to life, making it both expressive and timeless. Finished with secure screw back closures, the Black and White Diamond Earrings provide comfort and confidence, ensuring a snug fit ideal for all-day wear. Perfect for someone who adores unique jewelry with personality, these Cat Stud Earrings make a meaningful gift for anniversaries, birthdays, or spontaneous romantic gestures. Their compact size allows easy styling with everyday outfits, while the distinctive design ensures they never go unnoticed.

Product Information
SKU SHP-EARRINGS032230615
Length 12.3 mm
Width 7.5 mm
Metal Weight 1.67 gm (Approximate)
Total Stone Weight 0.84 Carat (Approximate)
SYNTHETIC BLACK DIAMOND INFORMATION
No.of Stones 2 Pieces
Total Weight 0.74 Carat (Approximate)
Dimension(approx) Heart-4X4 mm-2 Pcs
Color Black
Cut Brilliant
Shape Heart
Setting Type Prong-Setting
Quality Grade AAAA ( Synthetic )
DIAMOND INFORMATION
No.of Stones 20 Pieces
Total Weight 0.10 Carat (Approximate)
Dimension(approx) Round-0.90X0.90 mm-18 Pcs
Round-1.20X1.20 mm-2 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade SI
View More

Product Parent Collection Handle
lab-created-black-diamond-earrings