Heart Necklace with Lab Grown Diamond

Sale price $565.00 Regular price $649.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Chain Option
Star Icon

With 18 Inch Chain


Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Timeless Symbol in a Refined Form

This heart necklace with lab grown diamond is designed for those who appreciate meaningful jewelry with a clean, elegant presence. The heart silhouette offers a universal symbol of affection, while the diamond adds subtle brilliance that elevates the overall look.

As a standalone pendant necklace, it is suitable for gifting or personal wear, offering a balance between sentiment and everyday versatility.

Design and Setting Approach

The heart motif is shaped to maintain smooth curves and visual symmetry. The diamond is set to enhance light reflection while remaining secure within the design.

This thoughtful construction ensures the pendant sits comfortably when worn, making it appropriate for daily styling or special occasions.

Lab Grown Diamond Considerations

Lab grown diamonds share the same physical and optical properties as mined diamonds, making them suitable for regular wear in pendants and necklaces.

Created without traditional mining, lab grown diamonds offer an alternative sourcing method, though impact varies by production and energy source.

High-Level Features

  • Heart-shaped pendant design
  • Lab grown diamond accent
  • Balanced for everyday wear
  • Meaningful gift-ready style
Product Information
SKU SHP-PENDANT122310149
Metal Weight 3.50 gm (Approximate)
Total Stone Weight 0.27 Carat (Approximate)
LAB GROWN DIAMOND INFORMATION
No.of Stones 5 Pieces
Total Weight 0.27 Carat (Approximate)
Dimension(approx) Round-4X4 mm-1 Pcs
Round-1.10X1.10 mm-4 Pcs
Color E-F
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade VS
View More
Is this heart necklace suitable for everyday wear?
Yes, the lab grown diamond and secure setting make it suitable for regular wear. Routine care and gentle cleaning will help maintain its appearance.
What does a heart diamond necklace symbolize?
A heart design traditionally represents love, affection, and emotional connection, making it a popular choice for meaningful gifts.
Are lab grown diamonds real diamonds?
Yes, lab grown diamonds have the same physical, chemical, and optical properties as mined diamonds. The primary difference is their origin.
How should I care for this necklace?
Clean gently with mild soap and water, and store separately to avoid scratches. Periodic professional inspection can help ensure the setting remains secure.
Where can I find full product specifications?
Detailed information including metal options and diamond specifications is available in the product detail tables on this page.