Genuine Princess Cut Ethiopian Opal Promise Ring with Celtic Knot

Regular price $613.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


A Symbolic Promise with Distinct Character

This genuine princess cut Ethiopian opal promise ring is designed for those who value symbolism as much as visual presence. The structured square silhouette of the center stone contrasts beautifully with the flowing Celtic knot details, creating a piece that feels intentional and meaningful.

It is well suited for marking a promise, commitment, or personal milestone, offering individuality beyond traditional minimalist styles.

Celtic Knot Architecture

The Celtic knot motif along the band represents continuity and connection. Its interwoven structure adds depth and dimension to the profile, allowing the design to be appreciated from multiple angles rather than only from the top view.

This architectural detailing supports the center stone while giving the ring a distinctive identity that separates it from standard solitaire settings.

Light Behavior: Soft Internal Play-of-Color

Ethiopian opal is known for its internal play-of-color. In a princess cut, flashes appear within defined facets, creating a controlled yet dynamic glow that shifts as the hand moves. Rather than sharp sparkle, the effect is a soft, layered light that feels organic and expressive.

Thoughtful for Occasional or Gentle Wear

Opal is best suited for mindful wear. With proper care and storage, this ring can be enjoyed for meaningful occasions and daily moments that do not expose it to impact or harsh conditions.

Product Information
SKU SHP-RINGS0821141988
Width 3 mm
Height 5.5 mm
Metal Weight 2.40 gm (Approximate)
Center Stone Weight 0.70 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.70 Carat (Approximate)
Dimension(approx) Princess Cut-5X5 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Princess Cut
Setting Type Other-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
promise-rings

FAQs About: Genuine Princess Cut Ethiopian Opal Promise Ring with Celtic Knot

Is Ethiopian opal suitable for everyday wear?

Ethiopian opal is best worn with care. It should be protected from hard impact, chemicals, and prolonged moisture exposure to help preserve its surface and internal color play.

What does the Celtic knot design represent?

The Celtic knot is traditionally associated with continuity and interconnectedness, making it a meaningful choice for promise or commitment rings.

Can this ring be resized?

Resizing may be possible depending on the band structure. It is recommended to consult a professional jeweler to assess available adjustment options.

How should I clean this opal ring?

Clean gently using a soft cloth and mild soap with lukewarm water. Avoid ultrasonic cleaners and harsh chemicals to help maintain the stone’s integrity.

Is this ring suitable as a promise ring?

Yes, the combination of a symbolic Celtic knot and expressive opal center makes it well suited for marking a promise or meaningful milestone.