Genuine London Blue Topaz Flower Engagement Ring With Certificate

Regular price $604.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Product Details

Resembling a blossoming flower, this London Blue Topaz Engagement Ring embodies the essence of love in its most authentic state. A delicate arrangement of round-cut london blue topaz stones creates a floral motif at the center, imparting a natural and feminine touch to the Cluster Engagement Ring. The deep blue hue of the blue topaz presents a striking contrast against the polished band, casting a mysterious glow as it reflects light. Ideal for various occasions, this Flower Engagement Ring serves as a considerate gift for Valentine's Day, Christmas, New Year, or a December birthday. Whether presented as a promise, worn as an engagement ring, or given as a token of self-love, it carries profound sentiment. Crafted for comfortable daily wear or reserved for special occasions, this AAA quality London Blue Topaz Ring is presented in an exquisite gift box, ready to bring joy. With its gentle floral design and timeless charm, this Cluster Flower Ring serves as a reminder that love, much like nature, becomes increasingly beautiful over time.

Product Information
SKU SHP-RINGS0821190389
Width 11.8 mm
Height 4.5 mm
Metal Weight 1.84 gm (Approximate)
Total Stone Weight 1.25 Carat (Approximate)
LONDON BLUE TOPAZ INFORMATION
No.of Stones 7 Pieces
Total Weight 1.25 Carat (Approximate)
Dimension(approx) Round-3X3 mm-7 Pcs
Color Blue
Cut Brilliant
Shape Round
Setting Type Prong-Setting
Quality Grade AAA
View More

Product Parent Collection Handle
london-blue-topaz-rings