Genuine Ethiopian Opal Flower Engagement Ring with Diamond

Regular price $1,086.00
 Get Free Surprise Gift In Cart
Other Financing Options:klarnaafterpaycashappafterpayaffirm

Gemstone Quality
Metal: 92.5 Sterling Silver
Select Your Ring Size (US)
Size Guide
Made to Order  Ships by
Shop With Confidence
30 Days Free ReturnFree & Insured ShippingCertified Jewelry4.8/5 ReviewsPrecious Metal onlyChecked by Hand


Ethiopian Opal Flower Engagement Ring

The Genuine Ethiopian Opal Flower Engagement Ring with Diamond presents a distinctive design inspired by the delicate beauty of blooming flowers. At the center, the Ethiopian opal displays its natural play of color, creating shifting flashes of light that make each viewing angle unique. Surrounding diamond accents contribute subtle brilliance, enhancing the visual contrast between the opal’s soft iridescence and the crisp sparkle of diamonds.

Floral Inspired Setting

The ring’s flower-inspired structure brings together gemstones in a layered arrangement that resembles petals surrounding a central bloom. This design highlights the opal while allowing the diamond accents to frame the gemstone with balanced brilliance. The floral motif introduces depth and dimension while maintaining a refined and elegant silhouette suitable for an engagement ring.

Ethiopian Opal Characteristics

Ethiopian opals are appreciated for their vibrant play-of-color, displaying flashes of multiple hues when exposed to light. This optical phenomenon gives each stone a distinctive character, making every opal engagement ring visually unique. The gemstone’s luminous appearance adds an artistic quality to jewelry designs that emphasize individuality and color.

A Unique Gemstone Engagement Choice

Opal engagement rings are often chosen by individuals seeking a design that reflects creativity and personal style. The combination of Ethiopian opal and diamond accents within a flower-inspired arrangement creates a piece that blends expressive color with classic gemstone brilliance.

Product Information
SKU SHP-RINGS0821190053
Width 3.8 mm
Height 11 mm
Metal Weight 3.70 gm (Approximate)
Center Stone Weight 0.80 Carat (Approximate)
ETHIOPIAN OPAL INFORMATION
No.of Stones 1 Pieces
Total Weight 0.80 Carat (Approximate)
Dimension(approx) Round-6X6 mm-1 Pcs
Color Rainbow
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade AAA
DIAMOND INFORMATION
No.of Stones 28 Pieces
Total Weight 0.31 Carat (Approximate)
Dimension(approx) Round-1.10X1.10 mm-16 Pcs
Round-1.40X1.40 mm-12 Pcs
Color HI
Cut Brilliant
Shape Round
Setting Type Claw-Set
Quality Grade SI
View More

Product Parent Collection Handle
opal-engagement-rings
What makes Ethiopian opal unique?
Ethiopian opal is known for its play-of-color, where flashes of multiple colors appear as light moves across the stone. This effect gives each gemstone a distinctive visual character.
Why choose a flower engagement ring design?
Flower engagement ring designs use gemstone arrangements that resemble petals around a central stone, creating a decorative and nature-inspired appearance.
Are opal engagement rings different from traditional diamond rings?
Opal engagement rings feature a colorful center gemstone rather than a traditional diamond. They are often chosen by those who prefer distinctive color and unique gemstone patterns.
How should opal jewelry be cleaned?
Opal jewelry should be cleaned gently using mild soap, warm water, and a soft cloth. Avoid harsh chemicals or ultrasonic cleaners to protect the gemstone.
Do diamonds enhance opal jewelry designs?
Diamond accents can provide brightness and contrast that highlights the opal’s shifting colors, helping the center gemstone stand out within the design.